Prohibitin Antibody - #DF7600
Product: | Prohibitin Antibody |
Catalog: | DF7600 |
Description: | Rabbit polyclonal antibody to Prohibitin |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 30 kDa; 30kD(Calculated). |
Uniprot: | P35232 |
RRID: | AB_2841091 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7600, RRID:AB_2841091.
Fold/Unfold
Epididymis luminal protein 215; Epididymis secretory sperm binding protein Li 54e; HEL 215; HEL S 54e; PHB; PHB_HUMAN; PHB1; Prohibitin;
Immunogens
- P35232 PHB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P35232 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
K4 | Acetylation | Uniprot | |
K4 | Methylation | Uniprot | |
K4 | Ubiquitination | Uniprot | |
K11 | Methylation | Uniprot | |
R41 | Methylation | Uniprot | |
S82 | Phosphorylation | Uniprot | |
K83 | Ubiquitination | Uniprot | |
T91 | Phosphorylation | Uniprot | |
R93 | Methylation | Uniprot | |
S101 | Phosphorylation | Uniprot | |
T108 | Phosphorylation | Uniprot | |
S109 | Phosphorylation | Uniprot | |
Y114 | Phosphorylation | P06213 (INSR) | Uniprot |
S121 | O-Glycosylation | Uniprot | |
T123 | Phosphorylation | Uniprot | |
K128 | Acetylation | Uniprot | |
K128 | Ubiquitination | Uniprot | |
S151 | Phosphorylation | Uniprot | |
K177 | Ubiquitination | Uniprot | |
K186 | Ubiquitination | Uniprot | |
K202 | Acetylation | Uniprot | |
K202 | Ubiquitination | Uniprot | |
K207 | Acetylation | Uniprot | |
K208 | Ubiquitination | Uniprot | |
S213 | Phosphorylation | Uniprot | |
S218 | Phosphorylation | Uniprot | |
K219 | Ubiquitination | Uniprot | |
K240 | Ubiquitination | Uniprot | |
Y249 | Phosphorylation | Uniprot | |
S252 | Phosphorylation | Uniprot | |
S254 | Phosphorylation | Uniprot | |
T258 | O-Glycosylation | Uniprot | |
T258 | Phosphorylation | P31749 (AKT1) | Uniprot |
Y259 | Phosphorylation | Uniprot | |
S265 | Phosphorylation | Uniprot |
Research Backgrounds
Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.
Mitochondrion inner membrane. Nucleus.
Widely expressed in different tissues.
Interacts with PHB2. Interacts with STOML2.
Belongs to the prohibitin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.