ELOVL4 Antibody - #AF0604
Product: | ELOVL4 Antibody |
Catalog: | AF0604 |
Description: | Rabbit polyclonal antibody to ELOVL4 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 37kDa; 37kD(Calculated). |
Uniprot: | Q9GZR5 |
RRID: | AB_2834388 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0604, RRID:AB_2834388.
Fold/Unfold
3-keto acyl-CoA synthase ELOVL4; ADMD; Cancer/testis antigen 118; CT118; Elongation of very long chain fatty acids (FEN1/Elo2 SUR4/Elo3 yeast) like 4; Elongation of very long chain fatty acids like 4; Elongation of very long chain fatty acids protein 4; ELOV L4; ELOV4_HUMAN; ELOVL 4; ELOVL4; FLJ17667; FLJ92876; Stargardt disease 3; Stargardt disease 3 autosomal dominant; STGD 2; STGD 3; STGD2; STGD3;
Immunogens
Expressed in the retina and at much lower level in the brain. Ubiquitous, highest expression in thymus, followed by testis, small intestine, ovary, and prostate. Little or no expression in heart, lung, liver, or leukocates.
- Q9GZR5 ELOV4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9GZR5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N20 | N-Glycosylation | Uniprot | |
K35 | Ubiquitination | Uniprot | |
K280 | Ubiquitination | Uniprot | |
S292 | Phosphorylation | Uniprot | |
S294 | Phosphorylation | Uniprot | |
K296 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that catalyzes the synthesis of very long chain saturated (VLC-SFA) and polyunsaturated (PUFA) fatty acids that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May play a critical role in early brain and skin development.
N-glycosylated.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Expressed in the retina and at much lower level in the brain. Ubiquitous, highest expression in thymus, followed by testis, small intestine, ovary, and prostate. Little or no expression in heart, lung, liver, or leukocates.
Oligomer.
The C-terminal di-lysine motif confers endoplasmic reticulum localization.
Belongs to the ELO family. ELOVL4 subfamily.
Research Fields
· Metabolism > Lipid metabolism > Fatty acid elongation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.