Casein Kinase 2 beta Antibody - #DF7562
Product: | Casein Kinase 2 beta Antibody |
Catalog: | DF7562 |
Description: | Rabbit polyclonal antibody to Casein Kinase 2 beta |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | P67870 |
RRID: | AB_2841056 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7562, RRID:AB_2841056.
Fold/Unfold
Casein kinase 2 beta polypeptide; Casein kinase II beta subunit; Casein kinase II subunit beta; CK II beta; CK2B; CK2N; CSK2B; CSK2B_HUMAN; CSNK 2B; csnk2b; G5A; MGC138222; MGC138224; Phosvitin; Protein G5a;
Immunogens
- P67870 CSK2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P67870 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | P19784 (CSNK2A2) , P68400 (CSNK2A1) , P67870 (CSNK2B) | Uniprot |
S3 | Phosphorylation | P68400 (CSNK2A1) , P19784 (CSNK2A2) , P67870 (CSNK2B) | Uniprot |
S4 | Phosphorylation | Uniprot | |
S8 | Phosphorylation | Uniprot | |
S11 | Phosphorylation | Uniprot | |
K33 | Ubiquitination | Uniprot | |
T37 | Phosphorylation | Uniprot | |
S69 | Phosphorylation | Uniprot | |
R92 | Methylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
Y108 | Phosphorylation | Uniprot | |
K134 | Ubiquitination | Uniprot | |
K139 | Acetylation | Uniprot | |
K139 | Ubiquitination | Uniprot | |
Y144 | Phosphorylation | Uniprot | |
T145 | Phosphorylation | Uniprot | |
K147 | Acetylation | Uniprot | |
K147 | Ubiquitination | Uniprot | |
S148 | Phosphorylation | Uniprot | |
S149 | Phosphorylation | Uniprot | |
K177 | Ubiquitination | Uniprot | |
R178 | Methylation | Uniprot | |
R186 | Methylation | Uniprot | |
K191 | Ubiquitination | Uniprot | |
Y197 | Phosphorylation | Uniprot | |
S205 | Phosphorylation | Uniprot | |
K208 | Methylation | Uniprot | |
K208 | Ubiquitination | Uniprot | |
S209 | Phosphorylation | P06493 (CDK1) | Uniprot |
K212 | Acetylation | Uniprot | |
K212 | Sumoylation | Uniprot | |
K212 | Ubiquitination | Uniprot | |
T213 | Phosphorylation | O14757 (CHEK1) | Uniprot |
PTMs - P67870 As Enzyme
Substrate | Site | Source |
---|---|---|
O95863 (SNAI1) | S92 | Uniprot |
P04637-1 (TP53) | T18 | Uniprot |
P08473 (MME) | S6 | Uniprot |
P17509-1 (HOXB6) | S214 | Uniprot |
P35222 (CTNNB1) | S29 | Uniprot |
P35222 (CTNNB1) | T102 | Uniprot |
P35222 (CTNNB1) | T112 | Uniprot |
P35568 (IRS1) | S24 | Uniprot |
P35568 (IRS1) | T88 | Uniprot |
P35568 (IRS1) | S99 | Uniprot |
P35568 (IRS1) | S330 | Uniprot |
P35568 (IRS1) | T811 | Uniprot |
P38398-3 (BRCA1) | S468 | Uniprot |
P38398-8 (BRCA1) | S1525 | Uniprot |
P49427 (CDC34) | S203 | Uniprot |
P49427 (CDC34) | S222 | Uniprot |
P49427 (CDC34) | S231 | Uniprot |
P49427 (CDC34) | T233 | Uniprot |
P49427 (CDC34) | S236 | Uniprot |
P55010 (EIF5) | S174 | Uniprot |
P55010 (EIF5) | S389 | Uniprot |
P55010 (EIF5) | S390 | Uniprot |
P55957-1 (BID) | T59 | Uniprot |
P55957 (BID) | S64 | Uniprot |
P67870 (CSNK2B) | S2 | Uniprot |
P67870 (CSNK2B) | S3 | Uniprot |
Q01105-2 (SET) | S9 | Uniprot |
Q13158 (FADD) | S200 | Uniprot |
Q13422 (IKZF1) | S13 | Uniprot |
Q13422 (IKZF1) | T23 | Uniprot |
Q13422 (IKZF1) | S63 | Uniprot |
Q13422 (IKZF1) | S101 | Uniprot |
Q13422 (IKZF1) | S295 | Uniprot |
Q16625-1 (OCLN) | T404 | Uniprot |
Q16625-1 (OCLN) | S408 | Uniprot |
Q99523 (SORT1) | S825 | Uniprot |
Q9UBF6-3 (RNF7) | T10 | Uniprot |
Q9Y5B0-4 (CTDP1) | S575 | Uniprot |
Q9Y5B0 (CTDP1) | S740 | Uniprot |
Research Backgrounds
Participates in Wnt signaling (By similarity). Plays a complex role in regulating the basal catalytic activity of the alpha subunit.
Phosphorylated by alpha subunit.
Tetramer composed of an alpha subunit, an alpha' subunit and two beta subunits. The beta subunit dimerization is mediated by zinc ions. Interacts with TCTEX1D3 (By similarity). Interacts with CD163. Also component of a CK2-SPT16-SSRP1 complex composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B, the complex associating following UV irradiation. Interacts with MUSK; mediates phosphorylation of MUSK by CK2. Interacts with FGF1; this interaction is increased in the presence of FIBP, suggesting a possible cooperative interaction between CSNKB and FIBP in binding to FGF1.
Belongs to the casein kinase 2 subunit beta family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Adherens junction. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.