Product: ASC2 Antibody
Catalog: DF7540
Description: Rabbit polyclonal antibody to ASC2
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 10 kDa; 10kD(Calculated).
Uniprot: Q8WXC3
RRID: AB_2841039

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
ASC2 Antibody detects endogenous levels of total ASC2.
RRID:
AB_2841039
Cite Format: Affinity Biosciences Cat# DF7540, RRID:AB_2841039.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

PAAD domain only protein; PAAD-only protein 1; POP1; PYC1; PYD (pyrin domain) containing 1; PYDC1; PYDC1_HUMAN; Pyrin domain containing 1; Pyrin domain-containing protein 1; Pyrin only protein 1; Pyrin-only protein 1;

Immunogens

Immunogen:

A synthesized peptide derived from human ASC2, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q8WXC3 PYDC1_HUMAN:

Predominantly expressed in monocytes, macrophages and granulocytes.

Sequence:
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA

Research Backgrounds

Function:

Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.

PTMs:

Phosphorylated.

Subcellular Location:

Cytoplasm.
Note: Recruited to specks formed by PYCARD within the cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Predominantly expressed in monocytes, macrophages and granulocytes.

Research Fields

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

References

1). Traditional Chinese Medicine formula Dai-Zong-Fang alleviating hepatic steatosis in db/db mice via gut microbiota modulation. Frontiers in pharmacology, 2024 (PubMed: 38327989) [IF=5.6]

2). Integrated metabolomics and network pharmacology to explore the mechanism of Huzhang Erjin Decoction against ANIT-induced cholestatic hepatitis. Journal of ethnopharmacology, 2025 (PubMed: 40466881) [IF=4.8]

Application: WB    Species: Mouse    Sample:

Fig. 6. Mechanism validation results of HED in the treatment of cholestatic hepatitis. (A–G) Protein expression of PPARγ, NLRP3, pro caspase-1, IL-1β, and ASC was detected by Western blotting (n = 3). Compared with the control group, ∗P < 0.05, ∗∗P < 0.01. Compared with the model group, #P < 0.05, ##P < 0.01.

3). lncRNA‑MALAT1 promotes high glucose‑induced H9C2 cardiomyocyte pyroptosis by downregulating miR‑141‑3p expression. Molecular Medicine Reports, 2021 (PubMed: 33576445) [IF=3.4]

Application: WB    Species: Human    Sample: H9C2 cells

Figure 3. Effects of MALAT1 on pyroptosis-associated protein expression levels. ASC, GSDMD-N, caspase-1, NLRP3 and GSDMD protein expression levels were measured via western blotting. *P<0.05 and **P<0.01 vs. NG; #P<0.05 and ##P<0.01 vs. HG; ^P<0.05 and ^^P<0.01 vs. NC1; %P<0.05 vs. NC2. MALAT1, metastasis-associated lung adenocarcinoma transcript-1; ASC, apoptosis-associated speck-like protein; GSDMD, gasdermin D; NLRP3, nucleotide oligomerization domain-like receptor protein 3; NG, normal glucose; HG, high glucose; NC, negative control; NC1, MALAT1 overexpression NC group; NC2, MALAT1 knockdown NC group; si, small interfering RNA.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.