ASC2 Antibody - #DF7540

Product: | ASC2 Antibody |
Catalog: | DF7540 |
Description: | Rabbit polyclonal antibody to ASC2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 10 kDa; 10kD(Calculated). |
Uniprot: | Q8WXC3 |
RRID: | AB_2841039 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7540, RRID:AB_2841039.
Fold/Unfold
PAAD domain only protein; PAAD-only protein 1; POP1; PYC1; PYD (pyrin domain) containing 1; PYDC1; PYDC1_HUMAN; Pyrin domain containing 1; Pyrin domain-containing protein 1; Pyrin only protein 1; Pyrin-only protein 1;
Immunogens
- Q8WXC3 PYDC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA
Research Backgrounds
Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.
Phosphorylated.
Cytoplasm.
Note: Recruited to specks formed by PYCARD within the cytoplasm.
Predominantly expressed in monocytes, macrophages and granulocytes.
Interacts with PYCARD/ASC (via pyrin domain).
Research Fields
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
References
Application: WB Species: Human Sample: H9C2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.