ASH2 Antibody - #DF7528
Product: | ASH2 Antibody |
Catalog: | DF7528 |
Description: | Rabbit polyclonal antibody to ASH2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 60~80kD; 69kD(Calculated). |
Uniprot: | Q9UBL3 |
RRID: | AB_2841027 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7528, RRID:AB_2841027.
Fold/Unfold
ASH 2; Ash2 (absent small or homeotic) like; Ash2 (absent, small, or homeotic) like (Drosophila); ASH2; ASH2 LIKE; ASH2 like protein; ASH2-like protein; Ash2l; ASH2L_HUMAN; ASH2L1;antibody;ASH2L2; Bre 2; Bre2; Discs 2-like; Drosophila absent, small, or homeotic; Drosophila ASH2-like; Set1/Ash2 histone methyltransferase complex subunit ASH2;
Immunogens
Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes.
- Q9UBL3 ASH2L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UBL3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T84 | Phosphorylation | Uniprot | |
S92 | Phosphorylation | Uniprot | |
S101 | Phosphorylation | Uniprot | |
K193 | Ubiquitination | Uniprot | |
K195 | Ubiquitination | Uniprot | |
K253 | Ubiquitination | Uniprot | |
S262 | Phosphorylation | Uniprot | |
S291 | Phosphorylation | Uniprot | |
S292 | Phosphorylation | Uniprot | |
K294 | Acetylation | Uniprot | |
R296 | Methylation | Uniprot | |
K301 | Methylation | Uniprot | |
K312 | Ubiquitination | Uniprot | |
S316 | Phosphorylation | Uniprot | |
S321 | Phosphorylation | Uniprot | |
K338 | Ubiquitination | Uniprot | |
K357 | Ubiquitination | Uniprot | |
K366 | Ubiquitination | Uniprot | |
R388 | Methylation | Uniprot | |
K393 | Ubiquitination | Uniprot | |
R398 | Methylation | Uniprot | |
K405 | Ubiquitination | Uniprot | |
S459 | Phosphorylation | Uniprot | |
K467 | Ubiquitination | Uniprot | |
K500 | Ubiquitination | Uniprot | |
S501 | Phosphorylation | Uniprot | |
S516 | Phosphorylation | Uniprot | |
Y517 | Phosphorylation | Uniprot | |
Y519 | Phosphorylation | Uniprot | |
K531 | Ubiquitination | Uniprot | |
K534 | Ubiquitination | Uniprot | |
S623 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May function as a transcriptional regulator. May play a role in hematopoiesis. In association with RBBP5 and WDR5, stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A and SETD1B.
Both monomethylated and dimethylated on arginine residues in the C-terminus. Arg-296 is the major site. Methylation is not required for nuclear localization, nor for MLL complex integrity or maintenance of global histone H3K4me3 levels.
Nucleus.
Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes.
Interacts with HCFC1. Core component of several methyltransferase-containing complexes including MLL1/MLL, MLL2/3 (also named ASCOM complex) and MLL4/WBP7. Each complex is at least composed of ASH2L, RBBP5, WDR5, DPY30, one or more specific histone methyltransferases (KMT2A/MLL1, KMT2D/MLL2, KMT2C/MLL3 and KMT2B/MLL4), and the facultative components PAGR1, BAP18, CHD8, E2F6, HCFC1, HCFC2, HSP70, INO80C, KDM6A, KANSL1, LAS1L, MAX, MCRS1, MEN1, MGA, KAT8/MOF, NCOA6, PAXIP1/PTIP, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9, TEX10 and alpha- and beta-tubulin. Component of the SET1 complex, at least composed of the catalytic subunit (SETD1A or SETD1B), WDR5, WDR82, RBBP5, ASH2L/ASH2, CXXC1/CFP1, HCFC1 and DPY30. Found in a complex with RBBP5, ASH2L, DPY30, KMT2A, KMT2D and WDR5 (By similarity). Interacts with DPY30. Interacts with RBBP5. Interacts with SETD1A and SETD1B.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.