Phospho-Smad5 (Ser463/Ser465) Antibody - #DF2950
Product: | Phospho-Smad5 (Ser463/Ser465) Antibody |
Catalog: | DF2950 |
Description: | Rabbit polyclonal antibody to Phospho-Smad5 (Ser463/Ser465) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 58kDa; 52kD(Calculated). |
Uniprot: | Q99717 |
RRID: | AB_2840934 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2950, RRID:AB_2840934.
Fold/Unfold
DKFZp781C1895; DKFZp781O1323; Dwfc; hSmad5; JV5 1; JV5-1; MAD homolog 5; MAD, mothers against decapentaplegic homolog 5; MADH 5; MADH5; Mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; Mothers against DPP homolog 5; MusMLP; SMA and MAD related protein 5; SMAD 5; SMAD family member 5; SMAD, mothers against DPP homolog 5; Smad5; SMAD5_HUMAN;
Immunogens
- Q99717 SMAD5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99717 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T2 | Acetylation | Uniprot | |
S12 | Phosphorylation | Uniprot | |
K22 | Ubiquitination | Uniprot | |
K33 | Ubiquitination | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S58 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
K64 | Ubiquitination | Uniprot | |
S79 | Phosphorylation | Uniprot | |
K82 | Ubiquitination | Uniprot | |
Y89 | Phosphorylation | Uniprot | |
K117 | Sumoylation | Uniprot | |
K119 | Sumoylation | Uniprot | |
K119 | Ubiquitination | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
S133 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
S188 | Phosphorylation | Uniprot | |
K306 | Ubiquitination | Uniprot | |
S315 | Phosphorylation | Uniprot | |
K418 | Ubiquitination | Uniprot | |
S462 | Phosphorylation | Uniprot | |
S463 | Phosphorylation | Uniprot | |
S465 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD).
Phosphorylated on serine by BMP (bone morphogenetic proteins) type 1 receptor kinase.
Ubiquitin-mediated proteolysis by SMAD-specific E3 ubiquitin ligase SMURF1.
Cytoplasm. Nucleus.
Note: Cytoplasmic in the absence of ligand. Migrates to the nucleus when complexed with SMAD4.
Ubiquitous.
May form trimers with the co-SMAD SMAD4. Interacts with PEBP2-alpha subunit and SMURF1. Interacts with SUV39H1 and SUV39H2. Interacts (via MH2 domain) with LEMD3. Interacts with WWP1. Interacts with TMEM119 (By similarity). Interacts with ZNF8. Interacts with RANBP3L.
Belongs to the dwarfin/SMAD family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.