Id1 Antibody - #DF2932
![](/images/pubmed.gif)
Product: | Id1 Antibody |
Catalog: | DF2932 |
Description: | Rabbit polyclonal antibody to Id1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit |
Mol.Wt.: | 22kDa; 16kD(Calculated). |
Uniprot: | P41134 |
RRID: | AB_2840918 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2932, RRID:AB_2840918.
Fold/Unfold
bHLHb24; Class B basic helix-loop-helix protein 24; dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein); DNA binding protein inhibitor ID 1; DNA binding protein inhibitor ID1; DNA-binding protein inhibitor ID-1; Dominant negative helix loop helix protein; ID 1; ID; ID1; ID1_HUMAN; Inhibitor of Differentiation 1; Inhibitor of DNA binding 1; inhibitor of DNA binding 1, dominant negative helix-loop-helix protein;
Immunogens
- P41134 ID1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P41134 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K2 | Methylation | Uniprot | |
S5 | Phosphorylation | Uniprot | |
K20 | Acetylation | Uniprot | |
K20 | Ubiquitination | Uniprot | |
K23 | Ubiquitination | Uniprot | |
S36 | Phosphorylation | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K91 | Ubiquitination | Uniprot | |
S111 | Phosphorylation | Uniprot | |
T117 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity).
Cytoplasm. Nucleus.
Heterodimer with other HLH proteins. Interacts with COPS5, IFI204, GATA4 and NKX2-5 (By similarity). Interacts with CLOCK and ARNTL/BMAL1.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.