Product: Id1 Antibody
Catalog: DF2932
Description: Rabbit polyclonal antibody to Id1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit
Mol.Wt.: 22kDa(Observed); 16kD(Calculated).
Uniprot: P41134
RRID: AB_2840918

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(92%), Bovine(92%), Sheep(92%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
Id1 Antibody detects endogenous levels of total Id1.
RRID:
AB_2840918
Cite Format: Affinity Biosciences Cat# DF2932, RRID:AB_2840918.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

bHLHb24; Class B basic helix-loop-helix protein 24; dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein); DNA binding protein inhibitor ID 1; DNA binding protein inhibitor ID1; DNA-binding protein inhibitor ID-1; Dominant negative helix loop helix protein; ID 1; ID; ID1; ID1_HUMAN; Inhibitor of Differentiation 1; Inhibitor of DNA binding 1; inhibitor of DNA binding 1, dominant negative helix-loop-helix protein;

Immunogens

Immunogen:

A synthesized peptide derived from human Id1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Pig
92
Bovine
92
Sheep
92
Horse
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity).

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

References

1). Combined targeting of glioblastoma stem cells of different cellular states disrupts malignant progression. Nature communications, 2025 (PubMed: 40140646) [IF=16.6]

Application: WB    Species: Mouse    Sample:

Fig. 2: MEOX2 and SRGN are essential for GSCs proliferation, self-renewal, and stemness in CL and MES GSCs respectively. a, b Cell viability of indicated GSCs with shCONT, shMEOX2, or shSRGN measured by CellTiter-Glo assay (n = 6 per group). Data are presented as mean ± SD. c, e The number of spheres formed by CL and MES GSCs transduced with shCONT or shRNAs targeting MEOX2 or SRGN was quantified (n = 6 per group). Data are presented as mean ± SD. Box plots show median (center line), 25th–75th percentiles (box bounds), and whiskers extend to minimum and maximum values within 1.5 times the interquartile range. ns: non-significant. d, f In vitro limited dilution assay of CL and MES GSCs transduced with shCONT, shMEOX2-1/2 or shSRGN-1/2, respectively (n = 30 per group). χ2 test. g, j Heatmap of SOX2 and ID1 expression in MEOX2 and SRGN knockout RNA-seq data. h, k Quantitative RT-PCR assessment of SOX2 and ID1 mRNA levels in CL GSCs (3028, RKI) and MES GSCs (2907, 839) expressing shCONT, shMEOX2-1/2 or shSRGN-1/2, respectively. Data are presented as mean ± SD. n = 3 per group. i, l IB analysis of SOX2 and ID1 levels in CL GSCs (3028, RKI) and MES GSCs (2907, 839) transduced with shMEOX2, shSRGN, or control shRNA, respectively. m, o Bioluminescence imaging and quantification of orthotopic xenografts derived from luciferase-expressing 3028 (CL) and 2907 (2907) GSCs transduced with shCONT, shMEOX2, or shSRGN. Data are presented as mean ± SD. n = 3 per group. n, p Kaplan–Meier survival curves of mice bearing intracranial tumors derived from 3028 (CL) and 2907 (MES) GSCs (n = 6 per group) from the respective groups above. Statistics: a, b, c, e, m, o one-way ANOVA with Dunnett’s multiple-comparison test. d, f χ2 test for two-group comparison. h, k Unpaired Student’s t test for two-group comparison. n, p Log-rank test. Images: i, l Representative blots (n = 3). Source data are provided as a Source Data file.

2). Anti-angiogenesis effect of Baiying Juhua Decoction on the non-small cell lung cancer: integrating pharmacology, multi-machine learning and experimental investigation. Bioresources and bioprocessing, 2026 (PubMed: 41579221) [IF=4.6]

3). Alpha-1 antitrypsin protects against phosgene-induced acute lung injury by activating the ID1-dependent anti-inflammatory response. European journal of pharmacology, 2023 (PubMed: 37673367) [IF=4.2]

4). Construction and experimental validation of a macrophage cell senescence-related gene signature to evaluate the prognosis, immunotherapeutic sensitivity, and chemotherapy response in bladder cancer. Functional & Integrative Genomics, 2023 (PubMed: 37423913) [IF=3.9]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.