Cofilin Antibody - #AF0761

(1)   (5)  
Product: Cofilin Antibody
Catalog: AF0761
Description: Rabbit polyclonal antibody to Cofilin
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 19kDa; 19kD(Calculated).
Uniprot: Q9Y281 | P23528
RRID: AB_2834371

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Cofilin Antibody detects endogenous levels of total Cofilin.
RRID:
AB_2834371
Cite Format: Affinity Biosciences Cat# AF0761, RRID:AB_2834371.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CFL 2; CFL2; COF2_HUMAN; Cofilin 2 muscle; Cofilin; Cofilin muscle; Cofilin muscle isoform; Cofilin-2; Cofilin2; muscle isoform; NEM 7; NEM7; 18 kDa phosphoprotein; CFL 1; CFL; CFL1; COF1_HUMAN; Cofilin 1; Cofilin 1 non muscle; Cofilin; Cofilin non muscle isoform; Cofilin-1; epididymis secretory protein Li 15; HEL-S-15; non-muscle isoform; p18;

Immunogens

Immunogen:
Uniprot:

Q9Y281(COF2_HUMAN) >>Visit HPA database.

P23528(COF1_HUMAN) >>Visit HPA database.

Gene(ID):
CFL2(1073) | CFL1(1072)
Expression:
Q9Y281 COF2_HUMAN:

Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.

P23528 COF1_HUMAN:

Widely distributed in various tissues.

Description:
cofilin 1 a cytoskeletal protein that controls actin depolymerization. Has a 5-10-fold higher affinity for ATP-actin monomers than cofilin-1. May promote filament assembly rather than disassembly. Two alternatively spliced variants are described.
Sequence:
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q9Y281/P23528 As Substrate

Site PTM Type Enzyme
A2 Acetylation
S3 Phosphorylation Q15569 (TESK1) , Q96S53 (TESK2) , P53667 (LIMK1)
K13 Ubiquitination
K19 Acetylation
K19 Methylation
K19 Sumoylation
K19 Ubiquitination
S23 Phosphorylation
S24 Phosphorylation
K44 Acetylation
Y68 Phosphorylation
K73 Ubiquitination
Y82 Phosphorylation
Y85 Phosphorylation
T88 Phosphorylation
Y89 Phosphorylation
T91 Phosphorylation
K92 Acetylation
K92 Ubiquitination
S94 Phosphorylation
K95 Ubiquitination
K96 Acetylation
K96 Methylation
K96 Ubiquitination
S108 Phosphorylation
K112 Sumoylation
K112 Ubiquitination
K114 Acetylation
K114 Sumoylation
K114 Ubiquitination
Y117 Phosphorylation
S119 Phosphorylation
S120 Phosphorylation
K121 Acetylation
K121 Sumoylation
K121 Ubiquitination
K125 Acetylation
T129 Phosphorylation
K144 Ubiquitination
S160 Phosphorylation
Site PTM Type Enzyme
A2 Acetylation
S3 Phosphorylation P53671 (LIMK2) , P53667 (LIMK1) , Q13418 (ILK) , Q15139 (PRKD1) , Q96S53 (TESK2) , Q15569 (TESK1) , Q7Z2Y5 (NRK)
S8 Phosphorylation
K13 Acetylation
K13 Sumoylation
K13 Ubiquitination
K19 Acetylation
K19 Methylation
K19 Sumoylation
K19 Ubiquitination
K22 Ubiquitination
S23 Phosphorylation P17252 (PRKCA)
S24 Phosphorylation P17252 (PRKCA)
T25 Phosphorylation
K30 Acetylation
K30 Sumoylation
K30 Ubiquitination
K31 Acetylation
K33 Acetylation
K34 Sumoylation
K34 Ubiquitination
C39 S-Nitrosylation
S41 Phosphorylation
K44 Acetylation
K44 Sumoylation
K44 Ubiquitination
K45 Acetylation
K45 Sumoylation
K45 Ubiquitination
K53 Sumoylation
K53 Ubiquitination
T63 Phosphorylation
Y68 Phosphorylation P12931 (SRC)
T70 Phosphorylation
K73 Acetylation
K73 Ubiquitination
K78 Acetylation
K78 Ubiquitination
C80 S-Nitrosylation
Y82 Phosphorylation
Y85 Phosphorylation
T88 Phosphorylation
Y89 Phosphorylation
T91 Phosphorylation
K92 Acetylation
K92 Ubiquitination
S94 Phosphorylation
K95 Ubiquitination
K96 Acetylation
K96 Methylation
K96 Ubiquitination
S108 Phosphorylation
K112 Sumoylation
K112 Ubiquitination
K114 Acetylation
K114 Sumoylation
K114 Ubiquitination
Y117 Phosphorylation
S119 Phosphorylation
S120 Phosphorylation
K121 Acetylation
K121 Sumoylation
K121 Ubiquitination
K125 Acetylation
K126 Acetylation
K127 Acetylation
K127 Ubiquitination
T129 Phosphorylation
K132 Acetylation
K132 Sumoylation
K132 Ubiquitination
C139 S-Nitrosylation
Y140 Phosphorylation
K144 Acetylation
K144 Ubiquitination
C147 S-Nitrosylation
K152 Ubiquitination
S156 Phosphorylation
S160 Phosphorylation
K164 Sumoylation
K164 Ubiquitination

Research Backgrounds

Function:

Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere (By similarity).

PTMs:

The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal.

Subcellular Location:

Nucleus matrix. Cytoplasm>Cytoskeleton.
Note: Colocalizes with CSPR3 in the Z line of sarcomeres.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.

Subunit Structure:

Interacts with CSRP3; possibly two molecules of CFL2 can interact with one molecule if CSRP3.

Family&Domains:

Belongs to the actin-binding proteins ADF family.

Function:

Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. Regulates actin cytoskeleton dynamics. Important for normal progress through mitosis and normal cytokinesis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration (By similarity).

PTMs:

Inactivated by phosphorylation on Ser-3. Phosphorylated on Ser-3 in resting cells (By similarity). Dephosphorylated by PDXP/chronophin; this restores its activity in promoting actin filament depolymerization. The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal (By similarity). Phosphorylated via a ARRB1-RAC1-LIMK1-PAK1 cascade upon active ligand stimulation of atypical chemokine receptor ACKR2.

Subcellular Location:

Nucleus matrix. Cytoplasm>Cytoskeleton. Cell projection>Ruffle membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium.
Note: Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Detected at the cleavage furrow and contractile ring during cytokinesis. Almost completely in nucleus in cells exposed to heat shock or 10% dimethyl sulfoxide.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely distributed in various tissues.

Subunit Structure:

Can bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is a major component of intranuclear and cytoplasmic actin rods.

Family&Domains:

Belongs to the actin-binding proteins ADF family.

Research Fields

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Organismal Systems > Development > Axon guidance.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

References

1). Circ_0008673 regulates breast cancer malignancy by miR-153-3p/CFL2 axis. ARCHIVES OF GYNECOLOGY AND OBSTETRICS, 2022 (PubMed: 34324029) [IF=2.6]

Application: WB    Species: Human    Sample: breast tissues

Fig. 3 MiR-153-3p regulated breast cancer cell processes by binding to CFL2. A Dual-luciferase reporter assay was performed to demonstrate that miR-153-3p was directly associated with CFL2 in MCF-10AT and MCF-7 cells. B and C The protein level of CFL2 was detected by western blot in 42 pairs of breast cancer and paracancerous normal breast tissues as well as MCF-10A, MCF-10AT and MCF-7 cells. D–I MCF-10AT cells were transfected with in-miRNC, in-miR-153-3p, in-miR-153-3p+si-NC and in-miR-153-3p+si CFL2, respectively. D Cell viability was determined by CCK-8 assay. E Cell colony-forming ability was detected by cell colony-formation assay. F Cell apoptosis was analyzed by fow cytometry analysis. G and H Cell migratory and invasive capacities were determined by transwell assay. I The protein levels of E-cadherin and N-cadherin were determined by western blot analysis. A: adjacent normal breast tissues. T: breast cancer tissues. **P<0.01 and ***P<0.001

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.