CCR9 Antibody - #DF2910
| Product: | CCR9 Antibody |
| Catalog: | DF2910 |
| Description: | Rabbit polyclonal antibody to CCR9 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 45kDa; 42kD(Calculated). |
| Uniprot: | P51686 |
| RRID: | AB_2840899 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2910, RRID:AB_2840899.
Fold/Unfold
C C chemokine receptor D6; C C chemokine receptor type 9; C C CKR 9; CC Chemokine receptor CCR10; CC CKR 9; CCBP2; CCCKR9; CCR 9; CCR9; CDw199; CDw199 antigen; Chemokine (C C motif) receptor 9; Chemokine (C C motif) receptor 9, isoform CRA_a; Chemokine (C-C motif) receptor 9 isoform A; Chemokine (C-C motif) receptor 9 isoform B; Chemokine C C motif receptor 9; Chemokine C C receptor 10; Chemokine CC Motif Receptor 9; Chemokine receptor CCR 9; Chemokine receptor CCR9; Chemokine-binding protein D6; Cmkbr10; CMKBR9; G protein coupled receptor 28; GPR 28; GPR 9 6; GPR28; GPR96; OTTHUMP00000164653; OTTHUMP00000164654;
Immunogens
- P51686 CCR9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P51686 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T81 | Phosphorylation | Uniprot | |
| T83 | Phosphorylation | Uniprot | |
| Y145 | Phosphorylation | Uniprot | |
| S368 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.
(Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
Cell membrane>Multi-pass membrane protein.
Highly expressed in the thymus and low in lymph nodes and spleen.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.