CCL19 Antibody - #DF2909

(1)   (2)  
Product: CCL19 Antibody
Catalog: DF2909
Description: Rabbit polyclonal antibody to CCL19
Application: WB
Reactivity: Human, Mouse
Mol.Wt.: 11kDa; 11kD(Calculated).
Uniprot: Q99731
RRID: AB_2840898

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
CCL19 Antibody detects endogenous levels of total CCL19.
RRID:
AB_2840898
Cite Format: Affinity Biosciences Cat# DF2909, RRID:AB_2840898.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta chemokine exodus 3; Beta-chemokine exodus-3; C C chemokine ligand 19; C-C motif chemokine 19; CC chemokine ligand 19; CCL 19; CCL19; CCL19_HUMAN; Chemokine (C C motif) ligand 19; Chemokine (CC motif) ligand 19; Chemokine C C Motif Ligand 19; Chemokine CC Motif Ligand 19; CK beta 11; CK beta-11; CKb 11; CKb11; EBI 1 ligand chemokine; EBI1 ligand chemokine; ELC; Epstein-Barr virus-induced molecule 1 ligand chemokine; Exodus 3; Exodus3; Macrophage inflammatory protein 3 beta; MGC34433; MIP 3 beta; MIP 3B; MIP-3-beta; MIP-3b; MIP3 beta; MIP3B; OTTHUMP00000000531; SCYA 19; SCYA19; Small inducible cytokine A19; Small inducible cytokine subfamily A (Cys Cys) member 1; Small-inducible cytokine A19;

Immunogens

Immunogen:
Uniprot:

Q99731(CCL19_HUMAN) >>Visit HPA database.

Gene(ID):
CCL19(6363)
Expression:
Q99731 CCL19_HUMAN:

Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.

Sequence:
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Research Backgrounds

Function:

May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

References

1). IRF-1 contributes to the pathological phenotype of VSMCs during atherogenesis by increasing CCL19 transcription. Aging-US (PubMed: 33424012) [IF=5.2]

Application: WB    Species: Mouse    Sample: aorta tissues

Figure 1 CCL19 expression in AS. (A) Detection of CCL19 expression in peripheral blood of patients by ELISA. n=32. (B) qRT-PCR analysis of CCL19 mRNA levels normalized to GAPDH in AS mice aorta and normal aorta tissues. n=10. (C) CCL19 protein levels in the AS or normal mice aorta tissues was performed by western blot. n=4. (D) Representative images of IHC of CCL19 in AS model mice aorta tissues and normal aorta tissues. Bar=50 μm. The effect of different concentrations (E) or different duration (F) of PDGF-BB on the expression of CCL19 was detected by qRT-PCR. n=5. *P<0.05; **P<0.01; ***P<0.001.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.