Caspase 2 Antibody - #DF2908
Product: | Caspase 2 Antibody |
Catalog: | DF2908 |
Description: | Rabbit polyclonal antibody to Caspase 2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 48,30,12kDa; 51kD(Calculated). |
Uniprot: | P42575 |
RRID: | AB_2840897 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2908, RRID:AB_2840897.
Fold/Unfold
CASP 2; CASP-2; Casp2; CASP2_HUMAN; Caspase 2; Caspase 2 apoptosis related cysteine peptidase; Caspase-2 subunit p12; Caspase2; ICH 1; ICH 1 protease; ICH 1L; ICH1; ICH1 protease; ICH1L; NEDD-2; NEDD2; Neural precursor cell expressed developmentally down-regulated protein 2; PPP1R57; Protease ICH-1; Protein phosphatase 1 regulatory subunit 57;
Immunogens
Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.
- P42575 CASP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P42575 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S8 | Phosphorylation | Uniprot | |
K15 | Ubiquitination | Uniprot | |
R22 | Methylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
K77 | Sumoylation | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K93 | Ubiquitination | Uniprot | |
R107 | Methylation | Uniprot | |
S139 | Phosphorylation | P78527 (PRKDC) | Uniprot |
Y151 | Phosphorylation | Uniprot | |
K153 | Ubiquitination | Uniprot | |
S157 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
T160 | Phosphorylation | Uniprot | |
S164 | Phosphorylation | Uniprot | |
K168 | Ubiquitination | Uniprot | |
K177 | Ubiquitination | Uniprot | |
K214 | Ubiquitination | Uniprot | |
K254 | Ubiquitination | Uniprot | |
K335 | Ubiquitination | Uniprot | |
S340 | Phosphorylation | Uniprot | |
Y368 | Phosphorylation | Uniprot | |
T374 | Phosphorylation | Uniprot | |
K409 | Ubiquitination | Uniprot | |
K415 | Ubiquitination | Uniprot | |
Y420 | Phosphorylation | Uniprot | |
K430 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. Associates with PIDD1 and CRADD to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis in response to genotoxic stress.
The mature protease can process its own propeptide, but not that of other caspases.
Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.
Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a p18 subunit and a p12 subunit. Forms a complex named the PIDDosome with PIDD1 and CRADD. Interacts with NOL3 (via CARD domain); inhibits CASP2 activity in a phosphorylation-dependent manner.
The CARD domain mediates a direct interaction with CRADD.
Belongs to the peptidase C14A family.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.