TAS2R44 Antibody - #DF10302
Product: | TAS2R44 Antibody |
Catalog: | DF10302 |
Description: | Rabbit polyclonal antibody to TAS2R44 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | P59538 |
RRID: | AB_2840880 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10302, RRID:AB_2840880.
Fold/Unfold
T2R31; T2R31_HUMAN; T2R44; T2R53; TAS2R31; Taste receptor type 2 member 31; Taste receptor type 2 member 44; Taste receptor type 2 member 53;
Immunogens
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
- P59538 T2R31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLWVLLLNWYSTVFNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAVYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVLRQVRYWVKGEKPSSP
PTMs - P59538 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S216 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). Activated by the sulfonyl amide sweeteners saccharin and acesulfame K.
Membrane>Multi-pass membrane protein.
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
Belongs to the G-protein coupled receptor T2R family.
Research Fields
· Organismal Systems > Sensory system > Taste transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.