P2RY12 Antibody - #DF10263
Product: | P2RY12 Antibody |
Catalog: | DF10263 |
Description: | Rabbit polyclonal antibody to P2RY12 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Dog |
Mol.Wt.: | 39 kDa; 39kD(Calculated). |
Uniprot: | Q9H244 |
RRID: | AB_2840841 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10263, RRID:AB_2840841.
Fold/Unfold
ADP glucose receptor; ADP-glucose receptor; ADPG R; ADPG-R; ADPGR; BDPLT8; G protein coupled receptor SP1999; Gi coupled ADP receptor HORK 3; Gi coupled ADP receptor HORK3; HORK 3; HORK3; P2RY 12; P2RY12; P2T(AC); P2Y 12; P2Y purinoceptor 12; P2Y(12)R; P2Y(AC); P2Y(ADP); P2Y(cyc); P2Y12; P2Y12 platelet ADP receptor; P2Y12_HUMAN; Platelet ADP receptor; Purinergic receptor P2RY12; Purinergic receptor P2Y G protein coupled 12; Purinergic receptor P2Y12; Putative G protein coupled receptor; SP 1999; SP1999;
Immunogens
Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.
- Q9H244 P2Y12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H244 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S9 | Phosphorylation | Uniprot | |
T89 | Phosphorylation | Uniprot | |
Y105 | Phosphorylation | Uniprot | |
T107 | Phosphorylation | Uniprot | |
S262 | Phosphorylation | Uniprot | |
T264 | Phosphorylation | Uniprot | |
S318 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Cell membrane>Multi-pass membrane protein.
Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.
The transmembrane domain is composed of seven transmembrane helices; most of these are not strictly perpendicular to the plane of the membrane, but are tilted and/or kinked. Agonist binding promotes a conformation change in the extracellular loops that leads to an inward movement of the transmembrane helices. Antagonists such as AZD1283 can bind to an overlapping site, but block the inward movement of the transmembrane helices (PubMed:24670650, PubMed:24784220).
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Immune system > Platelet activation. (View pathway)
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.