DRD3 Antibody - #DF10212
Product: | DRD3 Antibody |
Catalog: | DF10212 |
Description: | Rabbit polyclonal antibody to DRD3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 44 kDa; 44kD(Calculated). |
Uniprot: | P35462 |
RRID: | AB_2815010 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10212, RRID:AB_2815010.
Fold/Unfold
3dopamine receptor; D; D(3) dopamine receptor; Dopamine D3 receptor; Dopamine receptor D3; DRD3; DRD3_HUMAN; ETM1; FET1;
Immunogens
- P35462 DRD3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P35462 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T142 | Phosphorylation | Uniprot | |
T225 | Phosphorylation | Uniprot | |
S229 | Phosphorylation | Q9UQM7 (CAMK2A) | Uniprot |
S233 | Phosphorylation | Uniprot | |
S257 | Phosphorylation | Uniprot | |
S285 | Phosphorylation | Uniprot | |
S287 | Phosphorylation | Uniprot | |
T289 | Phosphorylation | Uniprot | |
S302 | Phosphorylation | Uniprot | |
S309 | Phosphorylation | Uniprot |
Research Backgrounds
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Phosphorylated by GRK4 (GRK4-alpha and GRK4-gamma).
Palmitoylated.
Cell membrane>Multi-pass membrane protein.
Note: Both membrane-bound and scattered in the cytoplasm during basal conditions. Receptor stimulation results in the rapid internalization and sequestration of the receptors at the perinuclear area (5 and 15 minutes), followed by the dispersal of the receptors to the membrane (30 minutes). DRD3 and GRK4 co-localize in lipid rafts of renal proximal tubule cells.
Brain.
Interacts with CLIC6 (By similarity). Interacts with GRK4. Interacts with PALM. Interacts with FLNA (via filamin repeat 21); increases PKA-mediated phosphorylation of FLNA.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Nervous system > Dopaminergic synapse.
References
Application: WB Species: Sample: BMDMs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.