Product: DRD2 Antibody
Catalog: DF10211
Description: Rabbit polyclonal antibody to DRD2
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 51 kDa; 51kD(Calculated).
Uniprot: P14416
RRID: AB_2840790

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
DRD2 Antibody detects endogenous levels of total DRD2.
RRID:
AB_2840790
Cite Format: Affinity Biosciences Cat# DF10211, RRID:AB_2840790.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

D(2) dopamine receptor; D2 dopamine receptor; D2DR; D2R; Dopamine D2 receptor; Dopamine receptor D2; DRD 2; DRD2; DRD2_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human DRD2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Substance dependence > Cocaine addiction.

· Human Diseases > Substance dependence > Alcoholism.

· Organismal Systems > Nervous system > Dopaminergic synapse.

References

1). Oligo-Porphyran Ameliorates Neurobehavioral Deficits in Parkinsonian Mice by Regulating the PI3K/Akt/Bcl-2 Pathway. Marine Drugs, 2018 (PubMed: 29509717) [IF=5.4]

Application: WB    Species: mouse    Sample: striatum

Figure 3. |Effects of OP on the levels of expression of extracellular signal-regulated protein kinases 1 and 2 (ERK1/2), dopamine receptor D2 (DRD2), tyrosine hydroxylase (TH), and dopamine transporter(DAT) in the striatum. After pretreated with MPTP for seven days, the C57BL/6 mice were administrated with MA or different concentrations of OP for the followed seven days.(A): Original bands of ERK1/2, DRD2, TH, DAT, and β-actin.

2). Potential therapeutic mechanism of deep brain stimulation of the nucleus accumbens in obsessive-compulsive disorder. Frontiers in Cellular Neuroscience, 2023 (PubMed: 36687525) [IF=5.3]

Application: IHC    Species: Rat    Sample:

FIGURE 6 Differences in pathological sections among the control, sham stimulation and NAc-DBS groups. (A) Immunofluorescence staining for TH was performed to label all dopaminergic neurons in the VTA. (B) Immunofluorescence staining for TPH2 was performed to label all serotonergic neurons in the RN. (C,D) Immunohistochemical staining for DRD1 and DRD2 in the NAc. The top image is the NAc core, and the bottom image is the NAc shell. (E) The bar graph represents the mean level of the immunofluorescence intensity of TH in the VTA. (F) The bar graph represents the mean level of the immunofluorescence intensity of TPH2 in the RN. (G) The bar graphs represent the mean level of IOD of DRD1 in the core and shell of the NAc. (H) The bar graphs represent the mean level of IOD of DRD2 in the core and shell of the NAc. VTA, ventral tegmental area; TH, tyrosine hydroxylase; RN, raphe nuclei; TPH2, tryptophan hydroxylase-2; NAc, nucleus accumbens; DRD1, dopamine receptor-1; DRD2, dopamine receptor-2; IOD, integrated optical density. The data are presented as the mean ± SEM; n = 10 vs. n = 19 vs. n = 19 (immunofluorescence); n = 8 vs. n = 17 vs. n = 15 (immunohistochemistry); ***P < 0.001, **P < 0.01, *P < 0.05; ns, no significance.

3). Effects of electroacupuncture on the ventral tegmental area- nucleus accumbens dopamine pathway in rats with chronic sleep deprivation. Acupuncture in Medicine, 2023 (PubMed: 36655631) [IF=2.4]

4). Pramipexole has a neuroprotective effect in spinal cord injury and upregulates D2 receptor expression in the injured spinal cord tissue in rats. PeerJ, 2023 (PubMed: 37719118) [IF=2.3]

Application: WB    Species: Rat    Sample:

Figure 4: Pramipexole increases the expression of NeuN and DRD2 post-SCI in rats. (A) Western blot analysis of DRD2 expression level in the Brain, Sham, and SCI. (B) Quantitative analysis of DRD2 protein levels. (C) Western blot analysis of DRD2 and NeuN expression level in the spinal cord tissue at 28 days post-SCI. (D and E) Quantitative analysis of DRD2 (D) and NeuN (E) protein levels. (F) qRT‑PCR analysis showing the relative mRNA level of DRD2 in spinal cords from Sham, SCI, PPX-0.25, and PPX-2.0 (n = 3). (G) The immunohistochemical staining showing NeuN expression in the spinal cord at 28 days post-SCI. (H) Quantitative analysis of NeuN-positive cells at 28 days post-SCI (×400, scale = 20 µm, n = 3). *P < 0.05, **P < 0.01, ***P < 0.001.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.