DRD2 Antibody - #DF10211
Product: | DRD2 Antibody |
Catalog: | DF10211 |
Description: | Rabbit polyclonal antibody to DRD2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 51 kDa; 51kD(Calculated). |
Uniprot: | P14416 |
RRID: | AB_2840790 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10211, RRID:AB_2840790.
Fold/Unfold
D(2) dopamine receptor; D2 dopamine receptor; D2DR; D2R; Dopamine D2 receptor; Dopamine receptor D2; DRD 2; DRD2; DRD2_HUMAN;
Immunogens
- P14416 DRD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P14416 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T134 | Phosphorylation | Uniprot | |
T144 | Phosphorylation | Uniprot | |
S147 | Phosphorylation | Uniprot | |
S148 | Phosphorylation | Uniprot | |
T225 | Phosphorylation | Uniprot | |
S228 | Phosphorylation | Uniprot | |
S229 | Phosphorylation | Uniprot | |
S321 | Phosphorylation | Q00535 (CDK5) | Uniprot |
K324 | Methylation | Uniprot | |
K332 | Methylation | Uniprot | |
K336 | Methylation | Uniprot | |
S354 | Phosphorylation | Uniprot | |
S359 | Phosphorylation | Uniprot |
Research Backgrounds
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
Cell membrane>Multi-pass membrane protein.
Forms homo- and heterooligomers with DRD4. The interaction with DRD4 may modulate agonist-induced downstream signaling. Interacts with CADPS and CADPS2. Interacts with GPRASP1, PPP1R9B and CLIC6 (By similarity). Interacts with ARRB2 (By similarity). Interacts with HTR2A. Interacts with KCNA2 (By similarity). Interacts with GNAI2 isoform sGi2, the interaction allows the creation of an intracellular pool of DRD2 that can be released to cell surface upon agonist stimulation. Interacts with DRD1 (By similarity).
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Gap junction. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Substance dependence > Cocaine addiction.
· Human Diseases > Substance dependence > Alcoholism.
· Organismal Systems > Nervous system > Dopaminergic synapse.
References
Application: WB Species: mouse Sample: striatum
Application: IHC Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.