Product: HTR3B Antibody
Catalog: DF10195
Description: Rabbit polyclonal antibody to HTR3B
Application: WB
Reactivity: Human
Mol.Wt.: 50 kDa; 50kD(Calculated).
Uniprot: O95264
RRID: AB_2840774

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
HTR3B Antibody detects endogenous levels of total HTR3B.
RRID:
AB_2840774
Cite Format: Affinity Biosciences Cat# DF10195, RRID:AB_2840774.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

5 HT3 B; 5 HT3B; 5 HTR3B; 5 hydroxytryptamine 3 receptor B subunit; 5 hydroxytryptamine receptor 3B; 5 hydroxytryptamine serotonin receptor 3B; 5-HT3-B; 5-HT3B; 5-hydroxytryptamine receptor 3B; 5HT3B_HUMAN; 5HTR3B; Htr3b; Serotonin gated ion channel subunit; Serotonin receptor 3B;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
O95264 5HT3B_HUMAN:

Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and placenta.

Sequence:
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV

PTMs - O95264 As Substrate

Site PTM Type Enzyme
K37 Ubiquitination
N52 N-Glycosylation
T57 Phosphorylation
T58 Phosphorylation
N96 N-Glycosylation
N138 N-Glycosylation
N168 N-Glycosylation
N203 N-Glycosylation
R352 Methylation

Research Backgrounds

Function:

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

PTMs:

N-glycosylation required for membrane localization.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.
Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and placenta.

Subunit Structure:

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.

Family&Domains:

Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3B sub-subfamily.

Research Fields

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Sensory system > Taste transduction.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.