HTR3B Antibody - #DF10195
Product: | HTR3B Antibody |
Catalog: | DF10195 |
Description: | Rabbit polyclonal antibody to HTR3B |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 50 kDa; 50kD(Calculated). |
Uniprot: | O95264 |
RRID: | AB_2840774 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10195, RRID:AB_2840774.
Fold/Unfold
5 HT3 B; 5 HT3B; 5 HTR3B; 5 hydroxytryptamine 3 receptor B subunit; 5 hydroxytryptamine receptor 3B; 5 hydroxytryptamine serotonin receptor 3B; 5-HT3-B; 5-HT3B; 5-hydroxytryptamine receptor 3B; 5HT3B_HUMAN; 5HTR3B; Htr3b; Serotonin gated ion channel subunit; Serotonin receptor 3B;
Immunogens
Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and placenta.
- O95264 5HT3B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
PTMs - O95264 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K37 | Ubiquitination | Uniprot | |
N52 | N-Glycosylation | Uniprot | |
T57 | Phosphorylation | Uniprot | |
T58 | Phosphorylation | Uniprot | |
N96 | N-Glycosylation | Uniprot | |
N138 | N-Glycosylation | Uniprot | |
N168 | N-Glycosylation | Uniprot | |
N203 | N-Glycosylation | Uniprot | |
R352 | Methylation | Uniprot |
Research Backgrounds
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
N-glycosylation required for membrane localization.
Cell membrane>Multi-pass membrane protein.
Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.
Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and placenta.
Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.
Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3B sub-subfamily.
Research Fields
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Sensory system > Taste transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.