GH1 Antibody - #DF10188
Product: | GH1 Antibody |
Catalog: | DF10188 |
Description: | Rabbit polyclonal antibody to GH1 |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | P01241 |
RRID: | AB_2840767 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10188, RRID:AB_2840767.
Fold/Unfold
gH; GH-N; GH1; GHB5; GHN; Growth hormone 1; Growth hormone; Growth hormone B5; Growth hormone, normal; Growth hormone, pituitary; HG1; hGH-N; IGHD1B; Pituitary growth hormone; RNGHGP; SOMA_HUMAN; Somatotropin;
Immunogens
- P01241 SOMA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
PTMs - P01241 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y68 | Phosphorylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
T93 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
S132 | Phosphorylation | Uniprot | |
S176 | Phosphorylation | Uniprot |
Research Backgrounds
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Secreted.
Monomer, dimer, trimer, tetramer and pentamer, disulfide-linked or non-covalently associated, in homopolymeric and heteropolymeric combinations. Can also form a complex either with GHBP or with the alpha2-macroglobulin complex.
Belongs to the somatotropin/prolactin family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.