CDO1 Antibody - #DF10174
| Product: | CDO1 Antibody | 
| Catalog: | DF10174 | 
| Description: | Rabbit polyclonal antibody to CDO1 | 
| Application: | WB | 
| Cited expt.: | WB | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus | 
| Mol.Wt.: | 23 kDa; 23kD(Calculated). | 
| Uniprot: | Q16878 | 
| RRID: | AB_2840753 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10174, RRID:AB_2840753.
Fold/Unfold
CDO 1; CDO; CDO I; CDO-I; Cdo1; CDO1_HUMAN; CDOI; Cysteine dioxygenase type 1; Cysteine dioxygenase type I; Cytosolic cysteine dioxygenase;
Immunogens
A synthesized peptide derived from human CDO1, corresponding to a region within the internal amino acids.
Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells.
- Q16878 CDO1_HUMAN:
 - Protein BLAST With
 - NCBI/
 - ExPASy/
 - Uniprot
 
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
The thioether cross-link between Cys-93 and Tyr-157 plays a structural role through stabilizing the Fe(2+) ion, and prevents the production of highly damaging free hydroxyl radicals by holding the oxygen radical via hydroxyl hydrogen.
Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells.
Belongs to the cysteine dioxygenase family.
Research Fields
· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.
· Metabolism > Metabolism of other amino acids > Taurine and hypotaurine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.