GABARAPL2 Antibody - #DF10158
![](/images/pubmed.gif)
Product: | GABARAPL2 Antibody |
Catalog: | DF10158 |
Description: | Rabbit polyclonal antibody to GABARAPL2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 14 kDa; 14kD(Calculated). |
Uniprot: | P60520 |
RRID: | AB_2840737 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10158, RRID:AB_2840737.
Fold/Unfold
ATG8; ATG8C; FLC3A; GABA(A) receptor-associated protein-like 2; Gabarapl2; Gamma-aminobutyric acid receptor-associated protein-like 2; Ganglioside expression factor 2; GATE-16; GATE16; GBRL2_HUMAN; GEF-2; GEF2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; MAP1 light chain 3-related protein;
Immunogens
Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
- P60520 GBRL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P60520 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S10 | Phosphorylation | Uniprot | |
C15 | S-Nitrosylation | Uniprot | |
K20 | Ubiquitination | Uniprot | |
K24 | Acetylation | Uniprot | |
K24 | Ubiquitination | Uniprot | |
R28 | Methylation | Uniprot | |
K35 | Acetylation | Uniprot | |
S39 | Phosphorylation | Uniprot | |
K46 | Acetylation | Uniprot | |
K46 | Ubiquitination | Uniprot | |
K74 | Acetylation | Uniprot | |
K97 | Ubiquitination | Uniprot |
Research Backgrounds
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity). Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL2-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL2-II. ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes.
The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.
Golgi apparatus. Cytoplasmic vesicle>Autophagosome.
Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
Monomer. Interacts with GABRG2, NSF, GOSR1 and beta-tubulin (By similarity). Interacts with ATG3, ATG7, ATG13 and ULK1. Interacts with TP53INP1 and TP53INP2. Interacts with TBC1D25. Directly interacts with SQSTM1 and BNIP3. Interacts with TECPR2 and PCM1. Interacts with TBC1D5. Interacts with TRIM5. Interacts with MEFV and TRIM21. Interacts with WDFY3.
Belongs to the ATG8 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
· Organismal Systems > Nervous system > GABAergic synapse.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.