CD300LB Antibody - #DF10157
Product: | CD300LB Antibody |
Catalog: | DF10157 |
Description: | Rabbit polyclonal antibody to CD300LB |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 23 kDa; 23kD(Calculated). |
Uniprot: | A8K4G0 |
RRID: | AB_2840736 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10157, RRID:AB_2840736.
Fold/Unfold
CD_antigen=CD300b; CD300 antigen-like family member B; CD300 molecule-like family member b; CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; CMRF35-like molecule 7; CMRF35A2; Immune receptor expressed on myeloid cells 3; IREM 3; IREM3; Leukocyte mono-Ig-like receptor 5; LMIR5; TREM 5; TREM5; Triggering receptor expressed on myeloid cells 5; UNQ2530/PRO6029;
Immunogens
- A8K4G0 CLM7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT
PTMs - A8K4G0 As Substrate
Research Backgrounds
Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Phosphorylation on Tyr-188 by FYN is required for interaction with GRB2.
Cell membrane>Single-pass type I membrane protein.
Expressed exclusively in myeloid lineages.
Interacts with TYROBP, which enhances cell surface expression and activation properties. Interacts with GRB2 in the presence of FYN.
Belongs to the CD300 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.