Product: Cytochrome P450 2A6/7/13 Antibody
Catalog: DF10129
Source: Rabbit
Application: WB, ELISA(peptide)
Reactivity: Human
Prediction: Sheep
Mol.Wt.: 56 kD; 57kD,56kD(Calculated).
Uniprot: P11509 | P20853 | Q16696
RRID: AB_2840709

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Prediction:
Sheep(100%)
Clonality:
Polyclonal
Specificity:
Cytochrome P450 2A6/7/13 Antibody detects endogenous levels of total Cytochrome P450 2A6/7/13.
RRID:
AB_2840709
Cite Format: Affinity Biosciences Cat# DF10129, RRID:AB_2840709.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Coumarin 7 hydroxylase; Coumarin 7-hydroxylase; CP2A6_HUMAN; CPA6; CYP2A; CYP2A3; CYP2A6; CYPIIA6; Cytochrome P450 2A6; Cytochrome P450 IIA3; Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 6; Cytochrome P450(I); Cytochrome P450, family 2 subfamily A polypeptide 6; Flavoprotein linked monooxygenase; P450C2A; P450PB; Xenobiotic monooxygenase; CP2A7_HUMAN; CPA7; CPAD; CYP2A 7; CYP2A; CYP2A7; CYPIIA7; Cytochrome P450 2A7; Cytochrome P450 family 2 subfamily A polypeptide 7; Cytochrome P450 IIA4; Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 7; Cytochrome P450IIA4; P450 IIA4; CP2AD_HUMAN; CPAD; CYP2A; CYP2A13; CYPIIA13; Cytochrome P450 2A13; CYTOCHROME P450, SUBFAMILY IIA, POLYPEPTIDE 13;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P11509 CP2A6_HUMAN:

Liver.

Q16696 CP2AD_HUMAN:

Expressed in liver and a number of extrahepatic tissues, including nasal mucosa, lung, trachea, brain, mammary gland, prostate, testis, and uterus, but not in heart, kidney, bone marrow, colon, small intestine, spleen, stomach, thymus, or skeletal muscle.

Sequence:
MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR

MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMSFLPR

MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Sheep
100
Pig
0
Horse
0
Bovine
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P11509/P20853/Q16696 As Substrate

Site PTM Type Enzyme
S4 Phosphorylation
T16 Phosphorylation
S22 Phosphorylation
S131 Phosphorylation
R148 Methylation
R161 Methylation
T163 Phosphorylation
S175 Phosphorylation
T177 Phosphorylation
S183 Phosphorylation
S184 Phosphorylation
T295 Phosphorylation
S403 Phosphorylation
K436 Acetylation
T488 Phosphorylation
Site PTM Type Enzyme
S131 Phosphorylation
S175 Phosphorylation
T177 Phosphorylation
S183 Phosphorylation
S184 Phosphorylation
K436 Acetylation
T488 Phosphorylation
Site PTM Type Enzyme
S175 Phosphorylation
T177 Phosphorylation
S183 Phosphorylation
S184 Phosphorylation
Y351 Phosphorylation
K436 Acetylation
T482 Phosphorylation
T488 Phosphorylation

Research Backgrounds

Function:

Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Acts as a 1,4-cineole 2-exo-monooxygenase. Possesses low phenacetin O-deethylation activity.

Subcellular Location:

Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Liver.

Family&Domains:

Belongs to the cytochrome P450 family.

Function:

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Subcellular Location:

Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the cytochrome P450 family.

Function:

Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N,N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Possesses phenacetin O-deethylation activity.

Subcellular Location:

Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in liver and a number of extrahepatic tissues, including nasal mucosa, lung, trachea, brain, mammary gland, prostate, testis, and uterus, but not in heart, kidney, bone marrow, colon, small intestine, spleen, stomach, thymus, or skeletal muscle.

Family&Domains:

Belongs to the cytochrome P450 family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Biosynthesis of other secondary metabolites > Caffeine metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.