CDC14B/C Antibody - #DF10121

(2)  
Product: CDC14B/C Antibody
Catalog: DF10121
Description: Rabbit polyclonal antibody to CDC14B/C
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 60 kDa; 57kD,52kD(Calculated).
Uniprot: O60729 | A4D256
RRID: AB_2840701

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
CDC14B/C Antibody detects endogenous levels of total CDC14B/C.
RRID:
AB_2840701
Cite Format: Affinity Biosciences Cat# DF10121, RRID:AB_2840701.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CC14B_HUMAN; Cdc 14B; Cdc 14B1; Cdc 14B2; CDC 14B3; CDC14 cell division cycle 14 homolog B; CDC14 homolog B; Cdc14b; Cdc14B1; Cdc14B2; CDC14B3; Cell division cycle 14 homolog B; Dual specificity protein phosphatase CDC14B; hCDC 14B; hCDC14B; OTTHUMP00000063774;

Immunogens

Immunogen:
Uniprot:

O60729(CC14B_HUMAN) >>Visit HPA database.

A4D256(CC14C_HUMAN) >>Visit HPA database.

Gene(ID):
| CDC14B(8555)
Sequence:
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR

MRSSTLQDPRRRDPQDDVYVDITDRLRFAILYSRPKSASNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEAAYRILIFGDTPYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQRLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPKPYSDDDEINGVTQGDRSRALKRRRQSKTNDILLPSPLAVLTFTLCSVVIWWIVCDYILPILLF

PTMs - O60729/A4D256 As Substrate

Site PTM Type Enzyme
S9 Phosphorylation
S10 Phosphorylation
S18 Phosphorylation
S22 Phosphorylation
S110 Phosphorylation
T112 Phosphorylation
T147 Phosphorylation
T160 Phosphorylation
T426 Phosphorylation
Site PTM Type Enzyme
Y19 Phosphorylation
S80 Phosphorylation
T82 Phosphorylation
Y386 Phosphorylation
T396 Phosphorylation

Research Backgrounds

Function:

Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylates SIRT2 around early anaphase. Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases.

Subcellular Location:

Nucleus>Nucleolus. Nucleus>Nucleoplasm.
Note: Following DNA damage, translocates from the nucleolus to the nucleoplasm and interacts with FZR1/CDH1.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with FZR1/CDH1.

Family&Domains:

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.

Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily.

Function:

Dual-specificity phosphatase. Preferentially dephosphorylates proteins modified by proline-directed kinases (By similarity).

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass membrane protein.
Note: Retains its endoplasmic reticulum localization during mitosis.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.

Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.