XCL1/2 Antibody - #DF10119
| Product: | XCL1/2 Antibody |
| Catalog: | DF10119 |
| Description: | Rabbit polyclonal antibody to XCL1/2 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 13 kDa; 13kD(Calculated). |
| Uniprot: | Q9UBD3 | P47992 |
| RRID: | AB_2840699 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10119, RRID:AB_2840699.
Fold/Unfold
ATAC; C motif chemokine 1; Chemokine (C motif) ligand 1; Chemokine C Motif Ligand 1; Cytokine SCM-1; LPTN; LTN; Lymphotactin; Lymphotaxin; SCM 1 alpha; SCM 1; SCM 1a; SCM-1-alpha; SCM1; SCM1A; SCYC1; Single cysteine motif 1a; Small inducible cytokine C1; Small Inducible Cytokine Subfamily C Member 1; Small inducible cytokine subfamily C, member 1 (lymphotactin); Small-inducible cytokine C1; X-C motif chemokine ligand 1; XC chemokine ligand 1; Xcl1; XCL1_HUMAN;
Immunogens
Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
- Q9UBD3 XCL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
- P47992 XCL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
PTMs - Q9UBD3/P47992 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S27 | Phosphorylation | Uniprot | |
| T31 | Phosphorylation | Uniprot | |
| T51 | Phosphorylation | Uniprot |
Research Backgrounds
Chemotactic activity for lymphocytes but not for monocytes or neutrophils.
Secreted.
Belongs to the intercrine gamma family.
Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.
Secreted.
Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
Belongs to the intercrine gamma family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.