IL1F7 Antibody - #DF10112
| Product: | IL1F7 Antibody |
| Catalog: | DF10112 |
| Description: | Rabbit polyclonal antibody to IL1F7 |
| Application: | WB IHC |
| Reactivity: | Human |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q9NZH6 |
| RRID: | AB_2840692 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10112, RRID:AB_2840692.
Fold/Unfold
FIL1; FIL1 zeta; FIL1(ZETA); FIL1Z; IL 1 zeta; IL 1F7; IL 1F7b (IL 1H4, IL 1H, IL 1RP1); IL 1H4; IL 1RP1; IL 1X; IL 1X protein; IL-1 zeta; IL-1F7; IL-1H; IL-1H4; IL-1RP1; IL-1X; IL-37; IL1F7 (canonical product IL 1F7b); IL1F7; IL1F7_HUMAN; IL1H4; IL1RP1; Interleukin 1 family member 7; interleukin 1 family, member 7 (zeta); Interleukin 1 homolog 4; Interleukin 1 related protein; Interleukin 1 superfamily z; Interleukin 1 zeta; Interleukin 37; Interleukin-1 family member 7; Interleukin-1 homolog 4; Interleukin-1 zeta; Interleukin-1-related protein; Interleukin-23;
Immunogens
A synthesized peptide derived from human IL1F7, corresponding to a region within N-terminal amino acids.
In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.
- Q9NZH6 IL37_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Research Backgrounds
Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
Proteolytically converted to the mature form by CASP1.
Cytoplasm>Cytosol. Nucleus. Secreted.
Note: Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions (PubMed:20935647). Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation (PubMed:18390730).
In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.
Belongs to the IL-1 family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.