IL22RA2 Antibody - #DF10107
| Product: | IL22RA2 Antibody |
| Catalog: | DF10107 |
| Description: | Rabbit polyclonal antibody to IL22RA2 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 31 kDa; 31kD(Calculated). |
| Uniprot: | Q969J5 |
| RRID: | AB_2840687 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10107, RRID:AB_2840687.
Fold/Unfold
IL 22BP; IL 22RA2; IL22RA2; Class II cytokine receptor; CRF2 10; CRF2 S1; CRF2-10; CRF2-S1; CRF2X; Cytokine receptor class II member 10; Cytokine receptor class-II member 10; Cytokine receptor family 2 member 10; Cytokine receptor family type 2; Cytokine receptor family type 2 soluble 1; I22R2_HUMAN; IL 22 receptor subunit alpha 2; IL 22R alpha 2; IL-22 receptor subunit alpha-2; IL-22BP; IL-22R-alpha-2; IL-22RA2; IL22BP; IL22R alpha 2; Il22ra2; Interleukin 22 binding protein; Interleukin 22 Receptor alpha 2; Interleukin-22 receptor subunit alpha-2; Interleukin-22-binding protein; MGC150509; MGC150510; soluble 1; ZcytoR16;
Immunogens
Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expressed in placenta and breast and at lower level in spleen, skin, thymus and stomach.
- Q969J5 I22R2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Research Backgrounds
Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.
Isoform 1 may play a role in establishing and maintaining successful pregnancy.
Secreted.
Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expressed in placenta and breast and at lower level in spleen, skin, thymus and stomach.
Belongs to the type II cytokine receptor family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.