STAP-2 Antibody - #DF10085
| Product: | STAP-2 Antibody |
| Catalog: | DF10085 |
| Description: | Rabbit polyclonal antibody to STAP-2 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Rat, Pig, Bovine, Sheep, Dog |
| Mol.Wt.: | 45 kDa; 45kD(Calculated). |
| Uniprot: | Q9UGK3 |
| RRID: | AB_2840665 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10085, RRID:AB_2840665.
Fold/Unfold
BKS; Breast tumor kinase substrate; Brk kinase substrate; BRK substrate; Signal transducing adaptor protein 2; Signal-transducing adaptor protein 2; Ssignal transducing adaptor family member 2; STAP 2; STAP-2; STAP2; STAP2_HUMAN;
Immunogens
A synthesized peptide derived from human STAP-2, corresponding to a region within C-terminal amino acids.
- Q9UGK3 STAP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UGK3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y22 | Phosphorylation | P12931 (SRC) , O60674 (JAK2) | Uniprot |
| T191 | Phosphorylation | Uniprot | |
| Y204 | Phosphorylation | Uniprot | |
| Y250 | Phosphorylation | Q13882 (PTK6) , P12931 (SRC) , O60674 (JAK2) | Uniprot |
| Y256 | Phosphorylation | Uniprot | |
| T282 | Phosphorylation | Uniprot | |
| S289 | Phosphorylation | Uniprot | |
| Y310 | Phosphorylation | O60674 (JAK2) | Uniprot |
| Y322 | Phosphorylation | O60674 (JAK2) , P12931 (SRC) | Uniprot |
| K337 | Ubiquitination | Uniprot | |
| T388 | Phosphorylation | Uniprot |
Research Backgrounds
Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.
Phosphorylated on tyrosine. Tyr-250 may be important for interaction with kinases. Phosphorylated by PTK6 at Tyr-250 modulates PTK6-mediated STAT3 activation. Tyr-22 and Tyr-322 appears to be phosphorylated by SRC.
Cytoplasm.
Widely expressed.
Interacts with PTK6 and CSF1R.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.