TF2L1 Antibody - #DF10082
| Product: | TF2L1 Antibody |
| Catalog: | DF10082 |
| Description: | Rabbit polyclonal antibody to TF2L1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Dog |
| Mol.Wt.: | 55 kDa; 55kD(Calculated). |
| Uniprot: | Q9NZI6 |
| RRID: | AB_2840662 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10082, RRID:AB_2840662.
Fold/Unfold
CP2 related transcriptional repressor 1; CP2-related transcriptional repressor 1; CRTR 1; CRTR-1; LBP 9; LBP9; TF2L1_HUMAN; TFCP2 L1; TFCP2L1; Transcription factor CP2 like 1; Transcription factor CP2 like protein 1; Transcription factor CP2-like protein 1; Transcription factor LBP 9; Transcription factor LBP-9; Transcription factor LBP9;
Immunogens
Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue.
- Q9NZI6 TF2L1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NZI6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K30 | Sumoylation | Uniprot | |
| K30 | Ubiquitination | Uniprot | |
| S37 | Phosphorylation | Uniprot | |
| Y111 | Phosphorylation | Uniprot | |
| S137 | Phosphorylation | Uniprot | |
| K185 | Ubiquitination | Uniprot | |
| T195 | Phosphorylation | Uniprot | |
| K221 | Ubiquitination | Uniprot |
Research Backgrounds
Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs). With KLF2, acts as the major effector of self-renewal that mediates induction of pluripotency downstream of LIF/STAT3 and Wnt/beta-catenin signaling (By similarity). Required for normal duct development in the salivary gland and kidney (By similarity). Coordinates the development of the kidney collecting ducts intercalated (IC) and principal (PC) cells, which regulate acid-base and salt-water homeostasis, respectively (By similarity). Regulates the expression of IC genes including subunits B1 and D2 of the V-ATPase complex, OXGR1, CA12, SLC4A1, AQP6 and IC-specific transcription factor FOXI1 (By similarity). Regulates also the expression of JAG1 and subsequent notch signaling in the collecting duct (By similarity). JAG1 initiates notch signaling in PCs but inhibits notch signaling in ICs (By similarity). Acts as a transcriptional suppressor that may suppress UBP1-mediated transcriptional activation (By similarity). Modulates the placental expression of CYP11A1.
Nucleus.
Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue.
Forms homohexamers via its SAM-like domain. Interacts with MTA1; which is indispensable for TFCP2l1-mediated self-renewal-promoting effect and endoderm-inhibiting action (By similarity).
The CP2-like domain is required for direct DNA-binding (PubMed:26906118). The CP2-like domain is essential to maintain the undifferentiated state of embryonic stem cells (By similarity).
The SAM-like domain is required for homohexamerization (PubMed:26906118).
Belongs to the grh/CP2 family. CP2 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.