Product: Granzyme B/H Antibody
Catalog: AF0175
Description: Rabbit polyclonal antibody to Granzyme B/H
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Dog
Mol.Wt.: 28-40kDa(Glycosylation); 28kD,27kD(Calculated).
Uniprot: P10144 | P20718
RRID: AB_2833368

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(92%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Granzyme B/H Antibody detects endogenous levels of total Granzyme B/H.
RRID:
AB_2833368
Cite Format: Affinity Biosciences Cat# AF0175, RRID:AB_2833368.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C11; Cathepsin G like 1; Cathepsin G-like 1; CCPI; CGL 1; CGL1; CSP B; CSPB; CTLA-1; CTLA1; CTSGL1; Cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; Cytotoxic T lymphocyte proteinase 2; Cytotoxic T-lymphocyte proteinase 2; Fragmentin 2; Fragmentin-2; GRAB_HUMAN; Granzyme 2; Granzyme B (granzyme 2, cytotoxic T lymphocyte associated serine esterase 1); Granzyme B; Granzyme-2; GranzymeB; GRB; Gzmb; Hlp; Human lymphocyte protein; Lymphocyte protease; Protease, serine, B; SECT; T cell serine protease 1-3E; T-cell serine protease 1-3E; Cathepsin G like 2; Cathepsin G-like 2; CCP X; CCP-X; CGL 2; CGL2; CSP C; CSP-C; CTLA1; CTSGL2; Cytotoxic serine protease C; Cytotoxic T lymphocyte associated serine esterase 1; Cytotoxic T lymphocyte proteinase; Cytotoxic T-lymphocyte proteinase; EC 3.4.21.-; GRAH_HUMAN; Granzyme H (cathepsin G-like 2, protein h-CCPX); Granzyme H; GZMH; Protein h CCPX;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P20718 GRAH_HUMAN:

Constitutively expressed in NK cells.

Description:
GZMB This enzyme is necessary for target cell lysis in cell- mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. Belongs to the peptidase S1 family. Granzyme subfamily. Induced by staphylococcal enterotoxin A (SEA) in peripheral blood leukocytes.
Sequence:
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Dog
100
Horse
92
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P10144/P20718 As Substrate

Site PTM Type Enzyme
T150 Phosphorylation

Research Backgrounds

Function:

This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

Subcellular Location:

Cytoplasmic granule.
Note: Cytoplasmic granules of cytolytic T-lymphocytes and natural killer cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase S1 family. Granzyme subfamily.

Function:

Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.

Subcellular Location:

Cytoplasmic granule.
Note: Cytoplasmic granules of cytolytic T-lymphocytes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Constitutively expressed in NK cells.

Family&Domains:

Belongs to the peptidase S1 family. Granzyme subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Autoimmune thyroid disease.

· Human Diseases > Immune diseases > Allograft rejection.

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

References

1). pH-Triggered Copper-Free Click Reaction-Mediated Micelle Aggregation for Enhanced Tumor Retention and Elevated Immuno–Chemotherapy against Melanoma. ACS Applied Materials & Interfaces, 2021 (PubMed: 33834754) [IF=9.5]

Application: IHC    Species: mice    Sample: NK cells

Figure 6. (A) Immunofluorescent CLSM images of B16F10 tumor slices at the end of treatment, NK cells were identified by the antimouse NKp46 antibody (red), and nuclei were visualized by DAPI (blue). Scale bar: 100 μm. (B) Flow cytometric analysis of intratumor NK cell populations identified by PE-conjugated antimouse NKp46. Error bars indicate SD (n = 3). ** and *** represent p < 0.01 and p < 0.001, respectively. (C) Typical immunohistochemical images of the B16F10 tumor sections stained with antibodies against IL-2 and GZMB. Scale bar: 100 μm. (D) Levels of IL-2, GZMB, and IFN-γ in tumor and (E) plasma analyzed by ELISA kits at the end of treatment. Error bars indicate SD (n = 3), *, **, and *** represent p < 0.05, p < 0.01, and p < 0.001, respectively. (F) Images of the expression level of intratumor phosphorylated Smad3 (pSmad3) and Smad3 by western blotting analysis, (a) PBS, (b) M-D@DOX, (c) free DOX/SIS3, (d) M-N@SIS3, (e) M@DOX/SIS3, and (f) MDN@DOX/SIS3. (G) Semiquantitative results of the expression levels of p-Smad3 and Smad3. Error bars indicate SD (n = 3), ** and *** represent p < 0.01 and p < 0.001, respectively.

2). Baicalein enhances immune response in TNBC by inhibiting leptin expression of adipocytes. Cancer Science, 2023 (PubMed: 37489486) [IF=5.7]

Application: IHC    Species: Mouse    Sample:

FIGURE 6 Baicalein inhibits tumor growth and PD‐L1 expression in vivo. (A) Different nutrient calorie percentages of HFD and CD. (B) Schematic diagram of obesity modeling and subsequent intervention process. (C) ELISA detects serum leptin in HFD and CD mice. (D, E) Body weight growth curve and body weight difference for mice fed with CD or HFD. (F) Tumor growth curve and tumor size diagram for each subgroup, N = 6/subgroup. (G) Immunohistochemistry shows the expression of CD8, PD‐L1, LEP, GZMB, p‐STAT3, and SREBP1 in each subgroup. Scale bar = 100 μm. (H) H score for CD8, PD‐L1, LEP, GZMB, p‐STAT3, and SREBP1 in each subgroup and the statistical analysis of differences in each subgroup. (I) Schematic diagram of baicalein in inhibiting breast cancer (BC) by regulating the tumor microenvironment (Data are shown as the mean ± SD values. Significance was calculated using Student's t test.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.