TMEM37 Antibody - #DF10011
Product: | TMEM37 Antibody |
Catalog: | DF10011 |
Description: | Rabbit polyclonal antibody to TMEM37 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 21 kDa; 21kD(Calculated). |
Uniprot: | Q8WXS4 |
RRID: | AB_2840591 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10011, RRID:AB_2840591.
Fold/Unfold
CACNG5; CCGL_HUMAN; Neuronal voltage gated calcium channel gamma like subunit; Neuronal voltage-gated calcium channel gamma-like subunit; PR; PR1; Tmem37; Transmembrane protein 37; Voltage dependent calcium channel gamma subunit like protein; Voltage-dependent calcium channel gamma-like subunit;
Immunogens
- Q8WXS4 CCGL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE
Research Backgrounds
Thought to stabilize the calcium channel in an inactivated (closed) state. Modulates calcium current when coexpressed with CACNA1G (By similarity).
Membrane>Multi-pass membrane protein.
The L-type calcium channel is composed of five subunits: alpha-1, alpha-2/delta, beta and gamma.
Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.