UBE2G1 Antibody - #DF10001
Product: | UBE2G1 Antibody |
Catalog: | DF10001 |
Description: | Rabbit polyclonal antibody to UBE2G1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 20 kDa; 20kD(Calculated). |
Uniprot: | P62253 |
RRID: | AB_2840581 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10001, RRID:AB_2840581.
Fold/Unfold
E217K; UB2G1_HUMAN; UBC 7; UBC7; UBC7 homolog yeast; UBE 2G; UBE2G; Ube2g1; Ubiquitin carrier protein G1; Ubiquitin conjugating enzyme E2 G1; Ubiquitin conjugating enzyme E2G 1 (homologous to C. elegans UBC7); Ubiquitin conjugating enzyme E2G 1 (UBC7 homolog C. elegans); Ubiquitin conjugating enzyme E2G 1 (UBC7 homolog yeast); Ubiquitin conjugating enzyme E2G 1; Ubiquitin protein ligase G1; Ubiquitin-conjugating enzyme E2 G1; Ubiquitin-protein ligase G1;
Immunogens
- P62253 UB2G1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62253 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T2 | Acetylation | Uniprot | |
T2 | Phosphorylation | Uniprot | |
S6 | Phosphorylation | Uniprot | |
K19 | Ubiquitination | Uniprot | |
K63 | Ubiquitination | Uniprot | |
Y65 | Phosphorylation | Uniprot | |
K73 | Ubiquitination | Uniprot | |
T76 | Phosphorylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
Y102 | Phosphorylation | Uniprot | |
Y104 | Phosphorylation | Uniprot | |
K106 | Ubiquitination | Uniprot | |
K163 | Ubiquitination | Uniprot |
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. May be involved in degradation of muscle-specific proteins. Mediates polyubiquitination of CYP3A4.
Autoubiquitinated in vitro.
Widely expressed, mainly in skeletal muscle.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.