UBE2E3 Antibody - #DF10000
| Product: | UBE2E3 Antibody |
| Catalog: | DF10000 |
| Description: | Rabbit polyclonal antibody to UBE2E3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | Q969T4 |
| RRID: | AB_2840580 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10000, RRID:AB_2840580.
Fold/Unfold
Homologous to yeast UBC4/5; UB2E3_HUMAN; UBC E4; Ubc M2; UBC4/5 homolog; UBCE 4; UBCE4; UBCH 9; UbcH9; UbcM2; UBE2 E3; UBE2E3; Ubiquitin carrier protein; Ubiquitin carrier protein E3; Ubiquitin conjugating enzyme E2 23 kDa; Ubiquitin conjugating enzyme E2 E3; Ubiquitin conjugating enzyme E2E 3 (homologous to yeast UBC4/5); Ubiquitin conjugating enzyme E2E 3 (UBC4/5 homolog, yeast; Ubiquitin conjugating enzyme E2E 3; Ubiquitin conjugating enzyme UBCH 9; Ubiquitin conjugating enzyme UBCH9; Ubiquitin protein ligase; Ubiquitin protein ligase E3; Ubiquitin-conjugating enzyme E2 E3; Ubiquitin-conjugating enzyme E2-23 kDa; Ubiquitin-protein ligase E3;
Immunogens
A synthesized peptide derived from human UBE2E3, corresponding to a region within N-terminal amino acids.
- Q969T4 UB2E3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.
Nucleus. Cytoplasm.
Note: Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner.
Ubiquitously expressed at low levels. Highly expressed in skeletal muscle.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.