Product: Phospho-NDRG1 (Thr346) Antibody
Catalog: AF8494
Description: Rabbit polyclonal antibody to Phospho-NDRG1 (Thr346)
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 43kDa; 43kD(Calculated).
Uniprot: Q92597
RRID: AB_2840548

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(89%), Dog(100%), Xenopus(88%)
Clonality:
Polyclonal
Specificity:
Phospho-NDRG1 (Thr346) Antibody detects endogenous levels of NDRG1 only when phosphorylated at Thr346.
RRID:
AB_2840548
Cite Format: Affinity Biosciences Cat# AF8494, RRID:AB_2840548.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

42 kDa; Anti GC4; cap43; cmt4d; Differentiation related gene1 protein; Differentiation-related gene 1 protein; Drg 1; DRG-1; drg1; gc4; GC4 antibody; hmsnl; Human mRNA for RTP complete cds; N myc downstream regulated gene 1; N myc downstream regulated gene 1 protein; N-myc downstream-regulated gene 1 protein; Ndr 1; ndr1; NDRG 1; Ndrg1; NDRG1 protein; NDRG1_HUMAN; Nickel specific induction protein; Nickel specific induction protein Cap43; Nickel-specific induction protein Cap43; nmsl; Nmyc downstream regulated; Nmyc downstream regulated gene1; Nmyc downstream regulated gene1 protein; Protein NDRG1; Protein regulated by oxygen 1; Protein regulated by oxygen1; Proxy1; Reduced in tumor; Reducin; Reducing agents and tunicamycin responsive protein; Reducing agents and tunicamycin-responsive protein; Rit42; RTP; targ1; TDD5; tdds; Tunicamycin responsive protein;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q92597 NDRG1_HUMAN:

Ubiquitous; expressed most prominently in placental membranes and prostate, kidney, small intestine, and ovary tissues. Also expressed in heart, brain, skeletal muscle, lung, liver and pancreas. Low levels in peripheral blood leukocytes and in tissues of the immune system. Expressed mainly in epithelial cells. Also found in Schwann cells of peripheral neurons. Reduced expression in adenocarcinomas compared to normal tissues. In colon, prostate and placental membranes, the cells that border the lumen show the highest expression.

Sequence:
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
89
Xenopus
88
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q92597 As Substrate

Site PTM Type Enzyme
S2 Acetylation
S2 Phosphorylation
K14 Sumoylation
K14 Ubiquitination
K19 Ubiquitination
T47 Phosphorylation
K285 Ubiquitination
K300 Ubiquitination
K306 Ubiquitination
S319 Phosphorylation
S326 Phosphorylation
T328 Phosphorylation O00141 (SGK1)
S330 Phosphorylation P17612 (PRKACA) , O00141 (SGK1)
S332 Phosphorylation
S333 Phosphorylation
T335 Phosphorylation
S336 Phosphorylation
T340 Phosphorylation
S342 Phosphorylation P49841 (GSK3B) , P49840 (GSK3A)
S344 Phosphorylation
T346 Phosphorylation O00141 (SGK1)
S347 Phosphorylation
T350 Phosphorylation
S352 Phosphorylation P49841 (GSK3B) , P49840 (GSK3A)
S354 Phosphorylation
T356 Phosphorylation O00141 (SGK1)
S357 Phosphorylation
T360 Phosphorylation
S362 Phosphorylation P49841 (GSK3B) , P49840 (GSK3A)
S364 Phosphorylation
T366 Phosphorylation P17612 (PRKACA) , O00141 (SGK1)
S367 Phosphorylation
T375 Phosphorylation
S378 Phosphorylation
S384 Phosphorylation
S389 Phosphorylation
S393 Phosphorylation

Research Backgrounds

Function:

Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Has a role in cell trafficking, notably of the Schwann cell, and is necessary for the maintenance and development of the peripheral nerve myelin sheath. Required for vesicular recycling of CDH1 and TF. May also function in lipid trafficking. Protects cells from spindle disruption damage. Functions in p53/TP53-dependent mitotic spindle checkpoint. Regulates microtubule dynamics and maintains euploidy.

PTMs:

Under stress conditions, phosphorylated in the C-terminal on many serine and threonine residues. Phosphorylated in vitro by PKA. Phosphorylation enhanced by increased intracellular cAMP levels. Homocysteine induces dephosphorylation. Phosphorylation by SGK1 is cell cycle dependent.

Subcellular Location:

Cytoplasm>Cytosol. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Nucleus. Cell membrane.
Note: Mainly cytoplasmic but differentially localized to other regions. Associates with the plasma membrane in intestinal epithelia and lactating mammary gland. Translocated to the nucleus in a p53/TP53-dependent manner. In prostate epithelium and placental chorion, located in both the cytoplasm and in the nucleus. No nuclear localization in colon epithelium cells. In intestinal mucosa, prostate and renal cortex, located predominantly adjacent to adherens junctions. Cytoplasmic with granular staining in proximal tubular cells of the kidney and salivary gland ducts. Recruits to the membrane of recycling/sorting and late endosomes via binding to phosphatidylinositol 4-phosphate. Associates with microtubules. Colocalizes with TUBG1 in the centrosome. Cytoplasmic location increased with hypoxia. Phosphorylated form found associated with centromeres during S-phase of mitosis and with the plasma membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous; expressed most prominently in placental membranes and prostate, kidney, small intestine, and ovary tissues. Also expressed in heart, brain, skeletal muscle, lung, liver and pancreas. Low levels in peripheral blood leukocytes and in tissues of the immune system. Expressed mainly in epithelial cells. Also found in Schwann cells of peripheral neurons. Reduced expression in adenocarcinomas compared to normal tissues. In colon, prostate and placental membranes, the cells that border the lumen show the highest expression.

Subunit Structure:

Interacts with RAB4A (membrane-bound form); the interaction involves NDRG1 in vesicular recycling of CDH1.

Family&Domains:

Belongs to the NDRG family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.