Phospho-CBX1 / HP1 beta (Thr51) Antibody - #AF8483
Product: | Phospho-CBX1 / HP1 beta (Thr51) Antibody |
Catalog: | AF8483 |
Description: | Rabbit polyclonal antibody to Phospho-CBX1 / HP1 beta (Thr51) |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 25 kDa; 21kD(Calculated). |
Uniprot: | P83916 |
RRID: | AB_2840537 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8483, RRID:AB_2840537.
Fold/Unfold
CBX 1; CBX; Cbx1; CBX1_HUMAN; Chromobox 1; Chromobox homolog 1 (HP1 beta homolog Drosophila ); chromobox homolog 1; Chromobox protein homolog 1; Drosophila HP1 beta; Heterochromatin protein 1 beta; Heterochromatin protein 1 homolog beta; Heterochromatin protein p25; heterochromatin protein p25 beta; HP1 beta; HP1 beta homolog; HP1 beta homolog Drosophila; HP1, Drosophila. homolog of, beta; HP1beta; HP1Hs beta; HP1Hsbeta; Human heterochromatin protein p25 mRNA complete cds; M31; MOD 1; MOD1; Modifier 1 protein; p25beta;
Immunogens
- P83916 CBX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P83916 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K9 | Acetylation | Uniprot | |
K9 | Methylation | Uniprot | |
K9 | Ubiquitination | Uniprot | |
Y21 | Phosphorylation | Uniprot | |
K25 | Ubiquitination | Uniprot | |
K33 | Acetylation | Uniprot | |
K35 | Acetylation | Uniprot | |
K35 | Methylation | Uniprot | |
K35 | Ubiquitination | Uniprot | |
K41 | Acetylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
K43 | Ubiquitination | Uniprot | |
T51 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S70 | Phosphorylation | Uniprot | |
K72 | Ubiquitination | Uniprot | |
T73 | Phosphorylation | Uniprot | |
T77 | Phosphorylation | Uniprot | |
S80 | Phosphorylation | Uniprot | |
K84 | Acetylation | Uniprot | |
K84 | Ubiquitination | Uniprot | |
S89 | Phosphorylation | Uniprot | |
S91 | Phosphorylation | Uniprot | |
S98 | Phosphorylation | Uniprot | |
K104 | Ubiquitination | Uniprot | |
K109 | Ubiquitination | Uniprot | |
R111 | Methylation | Uniprot | |
R115 | Methylation | Uniprot | |
S128 | Phosphorylation | Uniprot | |
S129 | Phosphorylation | Uniprot | |
K139 | Acetylation | Uniprot | |
K139 | Ubiquitination | Uniprot | |
K150 | Ubiquitination | Uniprot | |
K155 | Ubiquitination | Uniprot | |
C156 | S-Nitrosylation | Uniprot | |
S172 | Phosphorylation | Uniprot | |
Y173 | Phosphorylation | Uniprot | |
S175 | Phosphorylation | Uniprot | |
K180 | Ubiquitination | Uniprot | |
K181 | Ubiquitination | Uniprot | |
K184 | Ubiquitination | Uniprot |
Research Backgrounds
Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
Not phosphorylated.
Ubiquitinated.
Nucleus.
Note: Unassociated with chromosomes during mitosis.
Expressed in all adult and embryonic tissues.
Homodimer (By similarity). Interacts directly with CHAF1A, EMSY, LBR, TIF1/TIF1A and TRIM28/TIF1B PXVXL motif via the chromoshadow domain. Interacts directly with histone H3 methylated at 'Lys-9' via the chromo domain (By similarity). Interacts with SUV39H1 and SETDB1, KMT5B and KMT5C. Interacts with PRDM6 (By similarity). Interacts with POGZ. Interacts with CHAMP1. Interacts with INCENP. Interacts with SGO1; the CBX1 homodimer binds to one molecule of SGO1. Interacts with LRIF1 (via PxVxL motif).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.