Phospho-YAP (Ser127) Antibody - #AF3328

(15)   (16)  
Product: Phospho-YAP (Ser127) Antibody
Catalog: AF3328
Description: Rabbit polyclonal antibody to Phospho-YAP (Ser127)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Zebrafish, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 65~78kD; 54kD(Calculated).
Uniprot: P46937
RRID: AB_2810276

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Zebrafish(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-YAP (Ser127) Antibody detects endogenous levels of YAP only when phosphorylated at Serine 127.
RRID:
AB_2810276
Cite Format: Affinity Biosciences Cat# AF3328, RRID:AB_2810276.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog;

Immunogens

Immunogen:
Uniprot:

P46937(YAP1_HUMAN) >>Visit HPA database.

Gene(ID):
YAP1(10413)
Expression:
P46937 YAP1_HUMAN:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Description:
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction.
Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Sheep
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Bovine
0
Dog
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P46937 As Substrate

Site PTM Type Enzyme
S61 Phosphorylation Q15208 (STK38) , Q13131 (PRKAA1)
T63 Phosphorylation
T77 Phosphorylation
T83 Phosphorylation
K90 Ubiquitination
S94 Phosphorylation Q13131 (PRKAA1)
K97 Acetylation
K97 Sumoylation
K97 Ubiquitination
K102 Ubiquitination
S103 Phosphorylation
S105 Phosphorylation
S109 Phosphorylation Q05513 (PRKCZ) , Q15208 (STK38)
T110 Phosphorylation Q05513 (PRKCZ)
T114 Phosphorylation
T119 Phosphorylation P06493 (CDK1) , P45984 (MAPK9)
S127 Phosphorylation Q15208 (STK38) , P31749 (AKT1) , Q9NRM7 (LATS2) , Q13188 (STK3) , Q9Y2H1 (STK38L) , O95835 (LATS1)
S128 Phosphorylation Q9UBE8 (NLK)
S131 Phosphorylation
S138 Phosphorylation P45984 (MAPK9)
T141 Phosphorylation
T143 Phosphorylation
T145 Phosphorylation
S149 Phosphorylation
T154 Phosphorylation P45984 (MAPK9)
T156 Phosphorylation
S163 Phosphorylation
S164 Phosphorylation Q15208 (STK38)
K181 Ubiquitination
Y188 Phosphorylation
S217 Phosphorylation
T241 O-Glycosylation
K254 Ubiquitination
S274 Phosphorylation
S276 Phosphorylation
K280 Sumoylation
K280 Ubiquitination
S289 Phosphorylation P06493 (CDK1)
S300 Phosphorylation
K315 Acetylation
K315 Ubiquitination
K321 Ubiquitination
S340 Phosphorylation
K342 Ubiquitination
T354 Phosphorylation
T361 Phosphorylation
S366 Phosphorylation
S367 Phosphorylation P45984 (MAPK9) , P06493 (CDK1)
S371 Phosphorylation
S381 Phosphorylation
S382 Phosphorylation
S388 Phosphorylation
T390 Phosphorylation
Y391 Phosphorylation
S397 Phosphorylation O95835 (LATS1) , Q9NRM7 (LATS2)
T398 Phosphorylation
S400 Phosphorylation P48730 (CSNK1D) , P49674 (CSNK1E)
S403 Phosphorylation P48730 (CSNK1D) , P49674 (CSNK1E)
S405 Phosphorylation
Y407 Phosphorylation P00519 (ABL1)
T412 Phosphorylation
S419 Phosphorylation
S473 Phosphorylation
K494 Methylation
K497 Methylation
K497 Ubiquitination
S499 Phosphorylation

Research Backgrounds

Function:

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.

Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).

PTMs:

Phosphorylated by LATS1 and LATS2; leading to cytoplasmic translocation and inactivation. Phosphorylated by ABL1; leading to YAP1 stabilization, enhanced interaction with TP73 and recruitment onto proapoptotic genes; in response to DNA damage. Phosphorylation at Ser-400 and Ser-403 by CK1 is triggered by previous phosphorylation at Ser-397 by LATS proteins and leads to YAP1 ubiquitination by SCF(beta-TRCP) E3 ubiquitin ligase and subsequent degradation. Phosphorylated at Thr-119, Ser-138, Thr-154, Ser-367 and Thr-412 by MAPK8/JNK1 and MAPK9/JNK2, which is required for the regulation of apoptosis by YAP1.

Ubiquitinated by SCF(beta-TRCP) E3 ubiquitin ligase.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is translocated to the cytoplasm at high density (PubMed:18158288, PubMed:20048001). PTPN14 induces translocation from the nucleus to the cytoplasm (PubMed:22525271).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Subunit Structure:

Binds to the SH3 domain of the YES kinase. Binds to WBP1 and WBP2. Binds, in vitro, through the WW1 domain, to neural isoforms of ENAH that contain the PPSY motif (By similarity). The phosphorylated form interacts with YWHAB. Interacts (via WW domains) with LATS1 (via PPxY motif 2). Interacts with LATS2. Isoform 2 and isoform 3 interact (via WW domain 1) with isoform 3 of ERBB4 (via PPxY motif 2). Interacts with TEAD1, TEAD2, TEAD3 and TEAD4. Interacts with TP73. Interacts with RUNX1. Interacts with HCK. Interacts (via WW domains) with PTPN14 (via PPxY motif 2); this interaction leads to the cytoplasmic sequestration of YAP1 and inhibits its transcriptional coactivator activity.

Family&Domains:

The first coiled-coil region mediates most of the interaction with TEAD transcription factors.

Belongs to the YAP1 family.

Research Fields

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway - multiple species.   (View pathway)

References

1). 3D-bioprinted GelMA nerve guidance conduits promoted peripheral nerve regeneration by inducing trans-differentiation of MSCs into SCLCs via PIEZO1/YAP axis. Materials Today Advances, 2023 [IF=10.0]

Application: WB    Species: Rat    Sample: MSCs

Fig. 4. The correlation between trans-differentiation and PIEZO1/YAP expression in MSCs. (A) Representative immunofluorescent images for the subcellular localization and activating states of YAP/TAZ in MSCs plating on GelMA and hard substrate (HS) before trans-differentiation. Scale bar:100 μm. (B) Representative immunofluorescent images for the activating states of YAP/TAZ and expression of S100β in GelMA and HS groups after trans-differentiation. Scale bar:100 μm. (C) Representative immunofluorescent images for the subcellular localization and activating states of YAP/TAZ and PIEZO1 in MSCs after trans-differentiation. Scale bar:10 μm. (D) Immunoblotted image for PIEZO2, PIEZO1, YAP/TAZ, p-YAP, GFAP, NGF, S100β in MSCs plating on GelMA and HS after co-culture with Ne–4C. (E) Densitometric analysis of blots showing the values of relevant proteins in GelMA and HS groups. (F) Immunoblotted image for PIEZO1, YAP/TAZ, p-YAP and GFAP in MSCs in co-culture system, after being treated with Yoda1 and GsMTx4. (G) Densitometric analysis of blots showing the values of relevant proteins in MSCs after being treated with Yoda1 and GsMTx4. (H) An indirect co-culture system including NE-4C in the upper chamber and MSCs plated on GelMA in the lower chambers.
2). A derivant of ginsenoside CK and its inhibitory effect on hepatocellular carcinoma. LIFE SCIENCES, 2022 (PubMed: 35690105) [IF=6.1]
3). Knockdown of HSP110 attenuates hypoxia-induced pulmonary hypertension in mice through suppression of YAP/TAZ-TEAD4 pathway. RESPIRATORY RESEARCH, 2022 (PubMed: 35986277) [IF=5.8]

Application: WB    Species: Mouse    Sample: lung tissues

Fig. 3Knockdown of HSP110 inhibits hypoxia-induced autophagy and YAP/TAZ-TEAD4 activity in mice. Relative mRNA level (a) and protein level (b, c) of HSP110 pulmonary arteries in lung tissues in each group (N = 8). d Double immunofluorescence staining of α-SMA (green) and HSP110 (red) in pulmonary arteries (N = 8). White scale bars, 50 μm; Yellow scale bars, 25 μm. White arrows pointed to α-SMA and HSP110 double-positive cells. e Protein levels of LC3II, LC3I, Beclin1, ATG5, ATG7 and p62 in pulmonary arteries (N = 8). f–h Quantitative analysis of relative protein ratio of LC3-II/I and relative protein level of Beclin1, p62, ATG5 and ATG7 (N = 8). i Double immunofluorescence staining of α-SMA (green) and Beclin 1 (red) in pulmonary arteries (N = 8). Scale bars, 50 μm. j Protein levels of p-YAP, YAP, p-TAZ and TAZ in pulmonary arteries (N = 8). k Quantitative analysis of relative protein ratio of p-YAP/t-YAP and p-TAZ/t-TAZ (N = 8). l–n Nuclear protein levels of YAP, TAZ and TEAD4 and quantitative analysis of relative protein level of nuclear YAP, TAZ and TEAD4 (N = 8). o Double immunofluorescence staining of α-SMA (green) and YAP (red) in pulmonary arteries (N = 8). White scale bars, 50 μm; Yellow scale bars, 25 μm. White arrows pointed to α-SMA and YAP double-positive cells. Data are means ± SD from 8 mice per group. *p 
4). Resveratrol Inhibits the Tumorigenesis of Follicular Thyroid Cancer via ST6GAL2-Regulated Activation of the Hippo Signaling Pathway. Molecular Therapy-Oncolytics, 2020 (PubMed: 32055676) [IF=5.7]

Application: WB    Species: human    Sample: FTC cells

Figure 4.| Upregulation of ST6GAL2 Rescues Tumorigenesis of FTC238 Cells and Resuppresses Hippo Signaling Pathway Activity(A–F) ST6GAL2 knockdown cells were transfected with ST6GAL2 overexpression vectors, and the proliferation,migration, and invasion capacities of FTC cells were enhanced. (G and H) Western blotting was performed to determine the levels of Hippo signaling molecules in FTC cells. *p < 0.05; scale bars, 20 mm.
5). Unveiling the mechanism of photothermal therapy in acne man-agement: targeting sebaceous gland ferroptosis via umbilical cord mesenchymal stem cell membrane-encapsulated Au-Ag-PDA. Frontiers in bioengineering and biotechnology, 2024 (PubMed: 38915336) [IF=5.7]
6). Salvianolic acid B ameliorates atherosclerosis via inhibiting YAP/TAZ/JNK signaling pathway in endothelial cells and pericytes. BIOCHIMICA ET BIOPHYSICA ACTA-MOLECULAR AND CELL BIOLOGY OF LIPIDS, 2020 (PubMed: 32739616) [IF=4.8]

Application: WB    Species: mouse    Sample: ECs

Fig. 5.| Influence of Sal-B on inflammatory response during YAP/TAZ/JNK signaling pathway in ECs. (A) Expression levels of YAP, TAZ, JNK, NF-κB and TNF-α were monitored by RT-PCR (n = 3). (B–C, F) Proteins (YAP, p-YAP, TAZ, p-TAZ, JNK, Nuclear NF-κB P65, Total P65 and TNF-α) in the pathway were detected by western blot (n = 3).
7). AT1R regulates macrophage polarization through YAP and regulates aortic dissection incidence. Frontiers in Physiology, 2021 (PubMed: 34305627) [IF=4.0]

Application: WB    Species: Mice    Sample: macrophages

FIGURE 6 Transfecting macrophages with a YAP siRNA further enhanced Ang II–induced macrophage M1 polarization and adhesion. (A) YAP siRNA efficiencies (n = 3, mean and S.D., t-test, &&P < 0.05 compared with siRNA NC;%%P < 0.05 compared with siRNA 860); (B,C) Western Blot of YAP after siRNA transfection *P < 0.05 compared with siRNA NC; (D) Flow cytometry analysis of CD68, CD86, and CD206 expression after 96 h co-culture in both groups. The data in the one-factor histogram represents the cells in the red circle in the upper scatter plot. HAECs + THP-1 + Ang II (1 μM, 24 h) + siRNA NC group: CD68, 41.94%; CD86, 45.73%; CD206, 9.72%. HAECs + THP-1 + Ang II + YAP siRNA group: CD68, 63.13%; CD86, 53.42%; CD206, 7.13%; (E–G) The proportion of CD68 +, CD86 +, and CD206 + cells, respectively (n = 3, mean and S.D., t-test, **P < 0.05 compared with the HAECs + THP-1 + siRNA NC group); (H) Fluorescence staining of adherent macrophages after YAP siRNA transfection. All cells were labeled with DAPI (blue), and the number of adherent macrophages was significantly decreased after transfection with the AT1R siRNA; (I) The ratio between the number of macrophages and the total number of cells (n = 3, mean and S.D., t-test, symbols are the same as in C,D,E).
8). Mechanical and signaling responses of unloaded rat soleus muscle to chronically elevated β-myosin activity. Archives of biochemistry and biophysics, 2024 (PubMed: 38492659) [IF=3.9]
9). Babaodan overcomes cisplatin resistance in cholangiocarcinoma via inhibiting YAP1. Pharmaceutical biology, 2024 (PubMed: 38571483) [IF=3.8]

Application: WB    Species: Human    Sample: CCAs

Figure 6. The extent of apoptosis, glutathione (GSH) synthesis, and the expression of DNA damage-related proteins were assessed in cholangiocarcinoma cells (CCAs) subjected to YAP1 knockdown or YAP1 overexpression. Western blot was used to measure protein levels (n = 3). With cisplatin incubation, YAP1 knockdown and 1 mg/mL babaodan (BBD) treatment decreased the (a) Bcl-2 level and (b) increased bax level, while the change in (c) cle-caspase-3/caspase-3 levels with BBD treatment was not statistically significant. In the CCAs dealing with cisplatin, the expression levels of (d) p-YAP1/YAP1, (e) ATF4, and (f) SLC1A5 were decreased by YAP1 knockdown and BBD treatment. Additionally, the (g) γH2Ax level was increased and (h) the ERCC1 level was inhibited by YAP1 knockdown and BBD treatment. YAP1 overexpression antagonized the effect of BBD on these proteins. Representative protein bands are shown in (i), (j), and (k). (mean ± standard deviation) +p 
10). Phosphorylation of YAP Impairs Trophoblast Invasion and Migration: Implications for the Pathogenesis of Fetal Growth Restriction. BIOLOGY OF REPRODUCTION, 2020 (PubMed: 32582940) [IF=3.6]

Application: WB    Species: Human    Sample: placenta

Fig. 1 Phosphorylation of YAP is upregulated in the trophoblasts of FGR-complicated placentas. (a) IHC staining of YAP and CK7 in first trimester villi of human placenta. CK7 was regarded as a positive control of STB and CTB in trophoblasts; scale bars, 100 μm. (b) IHC staining of YAP and CK7 in Normal and FGR term placenta. CK7 was regarded as a positive control of STB and CTB in trophoblasts; scale bar, 100 μm. (c) IHC staining of YAP and CK7 in E18.5 C57BL/6J mouse placenta. CK7 was regarded as a positive control of trophoblasts. (d) Western blotting of YAP and p-YAP in normal and FGR placentas. **P ＜ 0.01; Mann-Whitney U test. (e) mRNA levels of CTGF, CYR61 and AMOTL2 were measured by qRT-PCR and normalized to β-actin. **P < 0.01, *P < 0.05; Mann-Whitney U test. All data are presented as the mean ± SEM.

Application: IF/ICC    Species: Human    Sample: placenta

Fig. 2 Phosphorylation of YAP in the placenta ascends throughout pregnancy. (a) Images of YAP and p-YAP immunofluorescence staining of gradual gestational age (Week-9, Week-14, Week-17, Week-21, and Week-40) in human placenta. Scale bars, 200 μm. (b) Expression of p-YAP and YAP in human placenta with progressive gestational age determined by Western blotting. (c) Scanning images of YAP and p-YAP immunofluorescence staining of gradual gestational age (E8.5, E9.5, E10.5, E12.5, E13.5, E15.5, E16.5, and E18.5) in mouse placenta. (d) Expression of p-YAP and YAP in mouse placenta with increasing gestational age determined by Western blotting.
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.