Phospho-CRMP-1 (Thr509) Antibody - #AF8417
Product: | Phospho-CRMP-1 (Thr509) Antibody |
Catalog: | AF8417 |
Description: | Rabbit polyclonal antibody to Phospho-CRMP-1 (Thr509) |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 60~75kDa; 62kD(Calculated). |
Uniprot: | Q14194 |
RRID: | AB_2840475 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8417, RRID:AB_2840475.
Fold/Unfold
Collapsin response mediator protein 1; CRMP 1; CRMP-1; Crmp1; Dihydropyrimidinase like 1; Dihydropyrimidinase related protein 1; Dihydropyrimidinase-related protein 1; DPYL1_HUMAN; DPYSL1; DRP 1; DRP-1; DRP1; ULIP-3; Ulip3; Unc-33-like phosphoprotein 3;
Immunogens
- Q14194 DPYL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14194 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Phosphorylation | Uniprot | ||
S2 | Phosphorylation | Uniprot | |
S8 | Phosphorylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
Y32 | Phosphorylation | Uniprot | |
T101 | Phosphorylation | O14965 (AURKA) | Uniprot |
T102 | Phosphorylation | O14965 (AURKA) | Uniprot |
T253 | Phosphorylation | Uniprot | |
S257 | Phosphorylation | Uniprot | |
S259 | Phosphorylation | Uniprot | |
S304 | Phosphorylation | Uniprot | |
S308 | Phosphorylation | Uniprot | |
K374 | Ubiquitination | Uniprot | |
S385 | Phosphorylation | Uniprot | |
K398 | Acetylation | Uniprot | |
Y499 | Phosphorylation | Uniprot | |
Y504 | Phosphorylation | P06241 (FYN) | Uniprot |
T509 | Phosphorylation | P24941 (CDK2) , Q00535 (CDK5) , P49841 (GSK3B) | Uniprot |
Y512 | Phosphorylation | Uniprot | |
T514 | Phosphorylation | P49841 (GSK3B) | Uniprot |
S518 | Phosphorylation | P49841 (GSK3B) | Uniprot |
S521 | Phosphorylation | Uniprot | |
S522 | Phosphorylation | Q00535 (CDK5) , Q92630 (DYRK2) | Uniprot |
S524 | Phosphorylation | Uniprot | |
S542 | Phosphorylation | Uniprot | |
T569 | Phosphorylation | Uniprot | |
S570 | Phosphorylation | Uniprot |
Research Backgrounds
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis.
Phosphorylation at Ser-522 enhances CRMP1-mediated alteration of FLNA ternary structure and FLNA dissociation from F-actin.
Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle. Cell projection>Growth cone. Cytoplasm>Cytoskeleton. Perikaryon.
Note: Associated with centrosomes and the mitotic spindle during metaphase (PubMed:11562390). Colocalizes with FLNA and tubulin in the central region of DRG neuron growth cone (By similarity). Following SEMA3A stimulation of DRG neurons, colocalizes with F-actin (By similarity).
Brain.
Homotetramer, and heterotetramer with DPYSL2, DPYSL3, DPYSL4 or DPYSL5 (By similarity). Interacts with PLXNA1 (By similarity). Interacts with FLNA (via calponin-homology (CH) domain 1 and filamin repeat 24); the interaction alters FLNA ternary structure and thus promotes FLNA dissociation from F-actin.
Belongs to the metallo-dependent hydrolases superfamily. Hydantoinase/dihydropyrimidinase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.