Phospho-TPPP (Ser18) Antibody - #AF8329
Product: | Phospho-TPPP (Ser18) Antibody |
Catalog: | AF8329 |
Description: | Rabbit polyclonal antibody to Phospho-TPPP (Ser18) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Dog |
Mol.Wt.: | 24kDa; 24kD(Calculated). |
Uniprot: | O94811 |
RRID: | AB_2840391 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8329, RRID:AB_2840391.
Fold/Unfold
25 kDa brain specific protein; 25 kDa brain-specific protein; Brain specific protein p25 alpha; Glycogen synthase kinase 3 (GSK3) inhibitor p24; OTTHUMP00000161630; p24; p25; p25-alpha; p25alpha; TPPP; TPPP/p25; TPPP_HUMAN; TPPP1; Tubulin polymerization promoting protein; Tubulin polymerization-promoting protein;
Immunogens
- O94811 TPPP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O94811 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T14 | Phosphorylation | Q00535 (CDK5) , P28482 (MAPK1) | Uniprot |
S18 | Phosphorylation | P28482 (MAPK1) , Q00535 (CDK5) | Uniprot |
S23 | Phosphorylation | Uniprot | |
K24 | Acetylation | Uniprot | |
S32 | Phosphorylation | P17612 (PRKACA) | Uniprot |
S35 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S49 | Phosphorylation | Uniprot | |
K78 | Methylation | Uniprot | |
T92 | Phosphorylation | P17612 (PRKACA) | Uniprot |
S107 | Phosphorylation | Uniprot | |
S152 | O-Glycosylation | Uniprot | |
T155 | O-Glycosylation | Uniprot | |
S159 | Phosphorylation | P17612 (PRKACA) | Uniprot |
S160 | Phosphorylation | P28482 (MAPK1) , Q00535 (CDK5) | Uniprot |
T162 | Phosphorylation | Uniprot | |
K185 | Acetylation | Uniprot | |
K187 | Acetylation | Uniprot | |
K189 | Acetylation | Uniprot | |
Y201 | Phosphorylation | Uniprot | |
S203 | Phosphorylation | Uniprot |
Research Backgrounds
Regulator of microtubule dynamics that plays a key role in myelination by promoting elongation of the myelin sheath. Acts as a microtubule nucleation factor in oligodendrocytes: specifically localizes to the postsynaptic Golgi apparatus region, also named Golgi outpost, and promotes microtubule nucleation, an important step for elongation of the myelin sheath. Required for both uniform polarized growth of distal microtubules as well as directing the branching of proximal processes. Shows magnesium-dependent GTPase activity; the role of the GTPase activity is unclear. In addition to microtubule nucleation activity, also involved in microtubule bundling and stabilization of existing microtubules, thereby maintaining the integrity of the microtubule network. Regulates microtubule dynamics by promoting tubulin acetylation: acts by inhibiting the tubulin deacetylase activity of HDAC6. Also regulates cell migration: phosphorylation by ROCK1 inhibits interaction with HDAC6, resulting in increased acetylation of tubulin and increased cell motility. Plays a role in cell proliferation by regulating the G1/S-phase transition. Involved in astral microtubule organization and mitotic spindle orientation during early stage of mitosis; this process is regulated by phosphorylation by LIMK2.
Phosphorylated by LIMK1 on serine residues; phosphorylation may alter the tubulin polymerization activity. Phosphorylation by LIMK2, but not LIMK1, regulates astral microtubule organization at early stage of mitosis. Phosphorylation by ROCK1 at Ser-32, Ser-107 and Ser-159 inhibits interaction with HDAC6, resulting in increased acetylation of tubulin, increased cell motility and entry into S-phase. Phosphorylation by CDK1 inhibits the microtubule polymerizing activity.
Degraded by the proteasome; zinc-binding inhibits degradation by the proteasome.
Postsynaptic Golgi apparatus. Cytoplasm>Cytoskeleton>Microtubule organizing center. Cytoplasm>Cytoskeleton. Nucleus. Cytoplasm>Cytoskeleton>Spindle.
Note: Specifically localizes to the postsynaptic Golgi apparatus region, also named Golgi outpost, which shapes dendrite morphology by functioning as sites of acentrosomal microtubule nucleation (By similarity). Mainly localizes to the cytoskeleton (PubMed:18028908). Also found in the nucleus; however, nuclear localization is unclear and requires additional evidences (PubMed:18028908). Localizes to glial Lewy bodies in the brains of individuals with synucleinopathies (PubMed:15590652, PubMed:17027006). During mitosis, colocalizes with LIMK2 at the mitotic spindle (PubMed:22328514).
Widely expressed.
Homodimer. Binds tubulin; binding is inhibited by GTP. Interacts with MAPK1 (By similarity). Interacts with GAPDH; the interaction is direct (By similarity). Interacts with LIMK1 (via the PDZ domain); the interaction is direct. Interacts with LIMK2. Interacts with HDAC6; thereby inhibiting the tubulin deacetylase activity of HDAC6. Interacts with aggregated SNCA; may have a pro-aggregatory role in synucleinopathies. Interacts with DYNLL1.
Most of the protein is composed of disordered regions (PubMed:21316364). Zinc-binding induces structural rearrangement by promoting molten globule state formation (PubMed:21995432).
Belongs to the TPPP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.