Phospho-RGS19 (Ser151) Antibody - #AF8274
| Product: | Phospho-RGS19 (Ser151) Antibody |
| Catalog: | AF8274 |
| Description: | Rabbit polyclonal antibody to Phospho-RGS19 (Ser151) |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 25kDa; 25kD(Calculated). |
| Uniprot: | P49795 |
| RRID: | AB_2840336 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8274, RRID:AB_2840336.
Fold/Unfold
G alpha interacting protein; G protein signalling regulator 19; G protein, alpha-interacting protein; G-alpha-interacting protein; GAIP; GNAI3IP; Guanine nucleotide binding protein alpha inhibiting activity polypeptide 3 interacting protein; Regulator of G protein signalling 19; Regulator of G-protein signaling 19; RGS19; RGS19_HUMAN; RGSGAIP;
Immunogens
A synthesized peptide derived from human RGS19 around the phosphorylation site of Ser151.
Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.
- P49795 RGS19_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Activity on G(z)-alpha is inhibited by phosphorylation and palmitoylation of the G-protein.
Fatty acylated. Heavily palmitoylated in the cysteine string motif.
Phosphorylated, mainly on serine residues.
Membrane>Lipid-anchor.
Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.