Phospho-CDX2 (Ser283) Antibody - #AF8253
| Product: | Phospho-CDX2 (Ser283) Antibody |
| Catalog: | AF8253 |
| Description: | Rabbit polyclonal antibody to Phospho-CDX2 (Ser283) |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 40kd; 34kD(Calculated). |
| Uniprot: | Q99626 |
| RRID: | AB_2840315 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8253, RRID:AB_2840315.
Fold/Unfold
Caudal type homeo box 2; Caudal type homeo box transcription factor 2; Caudal type homeobox 2; Caudal type homeobox protein 2; Caudal type homeobox transcription factor 2; Caudal-type homeobox protein 2; CDX 2; CDX 3; CDX-3; Cdx2; CDX2/AS; CDX2_HUMAN; CDX3; Homeobox protein CDX 2; Homeobox protein CDX-2;
Immunogens
- Q99626 CDX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99626 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S4 | Phosphorylation | Uniprot | |
| S60 | Phosphorylation | Uniprot | |
| S176 | Phosphorylation | Uniprot | |
| S226 | Phosphorylation | Uniprot | |
| S277 | Phosphorylation | Uniprot | |
| S283 | Phosphorylation | P24941 (CDK2) , Q16539 (MAPK14) , P49841 (GSK3B) | Uniprot |
| S287 | Phosphorylation | P24941 (CDK2) , Q16539 (MAPK14) | Uniprot |
| S291 | Phosphorylation | P24941 (CDK2) , Q16539 (MAPK14) | Uniprot |
| S295 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
| T310 | Phosphorylation | Uniprot | |
| T312 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. Binds preferentially to methylated DNA.
Phosphorylation of Ser-60 mediates the transactivation capacity.
Nucleus.
Belongs to the Caudal homeobox family.
Research Fields
· Human Diseases > Cancers: Specific types > Gastric cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.