C1orf57 Antibody - #AF0448
| Product: | C1orf57 Antibody |
| Catalog: | AF0448 |
| Description: | Rabbit polyclonal antibody to C1orf57 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Bovine, Horse, Sheep, Rabbit |
| Mol.Wt.: | 21kDa; 21kD(Calculated). |
| Uniprot: | Q9BSD7 |
| RRID: | AB_2834309 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0448, RRID:AB_2834309.
Fold/Unfold
Chromosome 1 open reading frame 57; FLJ11383; HCR NTPase; Human cancer related NTPase; Hypothetical protein LOC84284; MGC13186; Novel DUF829 domain containing protein; Nucleoside triphosphatase C1orf57; Nucleoside triphosphatase, cancer related; Nucleoside triphosphate phosphohydrolase; OTTHUMP00000035941; OTTHUMP00000035942; Probable UPF0334 kinase like protein C1orf57; RP4 659I19.2; RP4 678E16.2;
Immunogens
- Q9BSD7 NTPCR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BSD7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| T8 | Phosphorylation | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| K21 | Acetylation | Uniprot | |
| K21 | Ubiquitination | Uniprot | |
| K27 | Ubiquitination | Uniprot | |
| Y37 | Phosphorylation | Uniprot | |
| T38 | Phosphorylation | Uniprot | |
| T54 | Phosphorylation | Uniprot | |
| S56 | Phosphorylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K150 | Ubiquitination | Uniprot | |
| K165 | Acetylation | Uniprot | |
| K165 | Ubiquitination | Uniprot | |
| T170 | Phosphorylation | Uniprot | |
| K171 | Ubiquitination | Uniprot |
Research Backgrounds
Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. Hydrolyzes nucleoside diphosphates with lower efficiency.
Monomer.
Belongs to the THEP1 NTPase family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Thiamine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.