Phospho-HAND1 (Ser98) Antibody - #AF8063
| Product: | Phospho-HAND1 (Ser98) Antibody |
| Catalog: | AF8063 |
| Description: | Rabbit polyclonal antibody to Phospho-HAND1 (Ser98) |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 23kDa; 24kD(Calculated). |
| Uniprot: | O96004 |
| RRID: | AB_2840126 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8063, RRID:AB_2840126.
Fold/Unfold
autonomic nervous system and neural crest derivatives-expressed protein 1; Basic helix loop helix transcription factor HAND1; bHLHa27; Class A basic helix-loop-helix protein 27; eHAND; Extraembryonic tissues; Extraembryonic tissues heart autonomic nervous system and neural crest derivatives expressed protein 1; HAND 1; HAND1; HAND1_HUMAN; Heart and neural crest derivatives expressed 1; Heart and neural crest derivatives expressed protein 1; heart; Heart- and neural crest derivatives-expressed protein 1; Hxt; Thing 1; Thing1; Thing1;
Immunogens
- O96004 HAND1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O96004 As Substrate
Research Backgrounds
Transcription factor that plays an essential role in both trophoblast giant cell differentiation and in cardiac morphogenesis (By similarity). Binds the DNA sequence 5'-NRTCTG-3' (non-canonical E-box) (By similarity). Acts as a transcriptional repressor of SOX15 (By similarity). In the adult, could be required for ongoing expression of cardiac-specific genes.
Phosphorylation by PLK4 disrupts the interaction with MDFIC and leads to translocation into the nucleoplasm, allowing dimerization and transcription factor activity.
Nucleus>Nucleoplasm. Nucleus>Nucleolus.
Note: Interaction with MDFIC sequesters it into the nucleolus, preventing the transcription factor activity. Phosphorylation by PLK4 disrupts the interaction with MDFIC and releases it from the nucleolus, leading to transcription factor activity (By similarity).
Heart.
Efficient DNA binding requires dimerization with another bHLH protein. Forms homodimers and heterodimers with TCF3 gene products E12 and E47, HAND2 and HEY1, HEY2 and HEYL (hairy-related transcription factors). Interacts with MDFIC (By similarity). Interacts with SOX15; the interaction enhances HAND1-induced differentiation of trophoblast giant cells (By similarity).
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.