GOT2 Antibody - #BF0444

(2)  
Product: GOT2 Antibody
Catalog: BF0444
Description: Mouse monoclonal antibody to GOT2
Application: WB IF/ICC ELISA
Reactivity: Human, Mouse, Rat, Monkey
Mol.Wt.: 47kDa; 48kD(Calculated).
Uniprot: P00505
RRID: AB_2833762

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IF/ICC 1:200-1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Clonality:
Monoclonal [AFB1738]
Specificity:
GOT2 antibody detects endogenous levels of total GOT2.
RRID:
AB_2833762
Cite Format: Affinity Biosciences Cat# BF0444, RRID:AB_2833762.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AATM_HUMAN; AL022787; Aspartate aminotransferase 2; Aspartate aminotransferase; Aspartate aminotransferase, mitochondrial; Aspartate transaminase 2; ASPATA; EC 2.6.1.1; FABP 1; FABP pm; FABP-1; FABPpm; Fatty acid binding protein; Fatty acid-binding protein; FLJ40994; Glutamate oxaloacetate transaminase 2; Glutamate oxaloacetate transaminase 2, mitochondrial; Glutamate oxaloacetate transaminase, mitochondrial; Glutamic oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); Got 2; GOT2; KAT4; KATIV; kynurenine aminotransferase 4; Kynurenine aminotransferase IV; kynurenine--oxoglutarate transaminase 4; kynurenine--oxoglutarate transaminase IV; mAspAT; MGC102129; MGC115763; mitAAT; mitochondrial; Mitochondrial aspartate aminotransferase; OTTMUSP00000017748; Plasma membrane fatty acid binding protein; Plasma membrane-associated fatty acid-binding protein; Transaminase A;

Immunogens

Immunogen:

Purified recombinant fragment of human GOT2 expressed in E. Coli.

Uniprot:

P00505(AATM_HUMAN) >>Visit HPA database.

Gene(ID):
GOT2(2806)
Description:
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Sequence:
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK

Research Backgrounds

Function:

Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.

Subcellular Location:

Mitochondrion matrix. Cell membrane.
Note: Exposure to alcohol promotes translocation to the cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.

Research Fields

· Metabolism > Amino acid metabolism > Arginine biosynthesis.

· Metabolism > Amino acid metabolism > Alanine, aspartate and glutamate metabolism.

· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.

· Metabolism > Amino acid metabolism > Arginine and proline metabolism.

· Metabolism > Amino acid metabolism > Tyrosine metabolism.

· Metabolism > Amino acid metabolism > Phenylalanine metabolism.

· Metabolism > Amino acid metabolism > Phenylalanine, tyrosine and tryptophan biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

· Metabolism > Global and overview maps > 2-Oxocarboxylic acid metabolism.

· Metabolism > Global and overview maps > Biosynthesis of amino acids.

· Organismal Systems > Digestive system > Fat digestion and absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.