AFfirm™ HO-1 Mouse Monoclonal Antibody - #BF8020

(9)   (4)  
Product: HO-1 Mouse Monoclonal Antibody
Catalog: BF8020
Description: Mouse monoclonal antibody to HO-1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Mol.Wt.: 33 kDa; 33kD(Calculated).
Uniprot: P09601

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm8020]
Specificity:
HO-1 Antibody detects endogenous levels of total HO-1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32;

Immunogens

Immunogen:

A synthesized peptide derived from human HO-1.

Uniprot:

P09601(HMOX1_HUMAN) >>Visit HPA database.

Gene(ID):
HMOX1(3162)
Expression:
P09601 HMOX1_HUMAN:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Sequence:
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Research Backgrounds

Function:

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Subcellular Location:

Microsome. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Family&Domains:

Belongs to the heme oxygenase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Digestive system > Mineral absorption.

References

1). Natural Linoleic Acid from Marine Fungus Eutypella sp. F0219 Blocks KEAP1/NRF2 Interaction and Ameliorates MASLD by Targeting FABP4. Free radical biology & medicine, 2024 (PubMed: 39299527) [IF=7.1]
2). The ferroptosis of sertoli cells inducing blood-testis barrier damage is produced by oxidative stress in cryptorchidism. Free radical biology & medicine, 2025 (PubMed: 40032029) [IF=7.1]
3). Molybdenum Nanoparticles Alleviate MC903-Induced Atopic Dermatitis-Like Symptoms in Mice by Modulating the ROS-Mediated NF-κB and Nrf2 /HO-1 Signaling Pathways. International journal of nanomedicine, 2024 (PubMed: 39220192) [IF=6.6]
4). Antioxidation and Anti-Inflammatory Activity of Prussian Blue Nanozymes to Alleviate Acetaminophen-Induced Acute Liver Injury. ACS Applied Nano Materials, 2023 [IF=5.9]
5). Bisphenol A induced neuronal apoptosis and enhanced autophagy in vitro through Nrf2/HO-1 and Akt/mTOR pathways. Toxicology, 2023 (PubMed: 38006930) [IF=4.8]
6). Effects of Oltipraz on the Glycolipid Metabolism and the Nrf2/HO-1 Pathway in Type 2 Diabetic Mice. Drug design, development and therapy, 2024 (PubMed: 39654602) [IF=4.7]

Application: WB    Species: Mouse    Sample:

Figure 5 OLTI showed an anti-oxidation stress and anti-apoptosis function in T2DM. (A–G) the expression of Nrf2, HO-1, NQO1, Bax, Bcl-2, Caspase-3, and Reg3g in mRNA level. (H–O) the expression of Nrf2, HO-1, NQO1, Bax, Bcl-2, Caspase-3, and Reg3g in protein level. *P
7). ROS Regulate Rotenone-induced SH-SY5Y Dopamine Neuron Death Through Ferroptosis-mediated Autophagy and Apoptosis. Molecular neurobiology, 2025 (PubMed: 40097764) [IF=4.6]
8). Oleanonic acid ameliorates mutant Aβ precursor protein-induced oxidative stress, autophagy deficits, ferroptosis, mitochondrial damage, and ER stress in vitro. Biochimica et biophysica acta. Molecular basis of disease, 2024 (PubMed: 39134286) [IF=4.2]
9). 4-Octyl itaconate alleviates experimental autoimmune prostatitis by inhibiting the NLRP3 inflammasome-induced pyroptosis through activating Nrf2/HO-1 pathway. The Prostate, 2024 (PubMed: 38073004) [IF=2.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.