CD59 Antibody - #BF0017
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# BF0017, RRID:AB_2834066.
Fold/Unfold
16.3A5; 1F5; 1F5 antigen; 20 kDa homologous restriction factor; CD 59; CD_antigen=CD59; CD59; CD59 antigen; CD59 antigen complement regulatory protein; CD59 antigen p18 20; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); CD59 glycoprotein; CD59 molecule; CD59 molecule complement regulatory protein; CD59_HUMAN; Cd59a; Complement regulatory protein; EJ16; EJ30; EL32; FLJ38134; FLJ92039; G344; HRF 20; HRF-20; HRF20; Human leukocyte antigen MIC11; Ly 6 like protein; Lymphocytic antigen CD59/MEM43; MAC inhibitory protein; MAC IP; MAC-inhibitory protein; MAC-IP; MACIF; MACIP; MEM43; MEM43 antigen; Membrane attack complex (MAC) inhibition factor; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MGC2354; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18 20; Protectin; Surface antigen recognized by monoclonal antibody 16.3A5; T cell activating protein;
Immunogens
Purified recombinant fragment of human CD59 expressed in E. Coli.
- P13987 CD59_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Research Backgrounds
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
N- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine. Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.
Glycated. Glycation is found in diabetic subjects, but only at minimal levels in nondiabetic subjects. Glycated CD59 lacks MAC-inhibitory function and confers to vascular complications of diabetes.
Cell membrane>Lipid-anchor. Secreted.
Note: Soluble form found in a number of tissues.
Research Fields
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
References
Application: WB Species: Human Sample: MOLM-13 and THP-1 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.