Product: CCNB1 Antibody
Catalog: BF0062
Description: Mouse monoclonal antibody to CCNB1
Application: WB IHC ELISA
Reactivity: Human, Mouse
Mol.Wt.: 60kDa; 48kD(Calculated).
Uniprot: P14635
RRID: AB_2833855

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFB1831]
Specificity:
CCNB1 antibody detects endogenous levels of total CCNB1.
RRID:
AB_2833855
Cite Format: Affinity Biosciences Cat# BF0062, RRID:AB_2833855.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CCNB 1; CCNB; ccnb1; CCNB1_HUMAN; Cyclin B1; G2 mitotic specific cyclin B1; G2/mitotic-specific cyclin-B1;

Immunogens

Immunogen:

Purified recombinant fragment of human CCNB1 expressed in E. Coli.

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase.
Sequence:
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

PTMs - P14635 As Substrate

Site PTM Type Enzyme
T6 Phosphorylation
S9 Phosphorylation
K25 Acetylation
K25 Ubiquitination
S35 Phosphorylation
K36 Ubiquitination
K51 Ubiquitination
S69 Phosphorylation
K73 Acetylation
S95 Phosphorylation
K111 Sumoylation
S116 Phosphorylation
S126 Phosphorylation P06493 (CDK1) , P28482 (MAPK1) , P53350 (PLK1)
S128 Phosphorylation P06493 (CDK1) , P53350 (PLK1) , P28482 (MAPK1)
S133 Phosphorylation P53350 (PLK1) , Q9H4B4 (PLK3)
S147 Phosphorylation P53350 (PLK1)
Y177 Phosphorylation
K190 Ubiquitination
K279 Ubiquitination
K311 Ubiquitination
T321 Phosphorylation
T362 Phosphorylation
T395 Phosphorylation
K396 Ubiquitination
K411 Ubiquitination
S413 Phosphorylation
K428 Ubiquitination

PTMs - P14635 As Enzyme

Substrate Site Source
Q06413-1 (MEF2C) S396 Uniprot
Q92993-1 (KAT5) S86 Uniprot
Q92993-2 (KAT5) S90 Uniprot
Q92993-3 (KAT5) S119 Uniprot
Q92993-3 (KAT5) S123 Uniprot
Q96KB5-1 (PBK) T9 Uniprot

Research Backgrounds

Function:

Essential for the control of the cell cycle at the G2/M (mitosis) transition.

PTMs:

Ubiquitinated by the SCF(NIPA) complex during interphase, leading to its destruction. Not ubiquitinated during G2/M phases.

Phosphorylated by PLK1 at Ser-133 on centrosomes during prophase: phosphorylation by PLK1 does not cause nuclear import. Phosphorylation at Ser-147 was also reported to be mediated by PLK1 but Ser-133 seems to be the primary phosphorylation site.

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with the CDC2 protein kinase to form a serine/threonine kinase holoenzyme complex also known as maturation promoting factor (MPF). The cyclin subunit imparts substrate specificity to the complex. Binds HEI10. Interacts with catalytically active RALBP1 and CDC2 during mitosis to form an endocytotic complex during interphase. Interacts with CCNF; interaction is required for nuclear localization. Interacts with CDK5RAP3. Interacts with RFPL4A and UBE2A (By similarity). Interacts with INCA1.

Family&Domains:

Belongs to the cyclin family. Cyclin AB subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.