INHA Antibody - #BF0628

(2)  
Product: INHA Antibody
Catalog: BF0628
Description: Mouse monoclonal antibody to INHA
Application: WB IF/ICC ELISA
Reactivity: Human, Mouse
Mol.Wt.: 40kDa; 40kD(Calculated).
Uniprot: P05111
RRID: AB_2833852

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IF/ICC 1:200-1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFB1828]
Specificity:
INHA antibody detects endogenous levels of total INHA.
RRID:
AB_2833852
Cite Format: Affinity Biosciences Cat# BF0628, RRID:AB_2833852.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

A inhibin subunit; A inhibin subunit precursor; AW55578; IHA; inhA; INHA_HUMAN; Inhibin alpha chain; Inhibin alpha chain precursor; Inhibin alpha subunit;

Immunogens

Immunogen:

Purified recombinant fragment of human INHA expressed in E. Coli.

Uniprot:

P05111(INHA_HUMAN) >>Visit HPA database.

Gene(ID):
INHA(3623)
Expression:
P05111 INHA_HUMAN:

Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fasciculata in the normal gland, extending centripetally into the zona fasciculata in hyperplasia. Also found in adrenocortical tumors. Also expressed in prostate epithelium of benign prostatic hyperplasia, in regions of basal cell hyperplasia and in nonmalignant regions of high grade prostate cancer. Only circulating inhibin B is found in male, whereas circulating inhibins A and B are found in female.

Description:
Inhibins are peptide hormones produced by the granulosa cells in female follicles and by Sertoli cells in the male seminiferous tubules. They are selectively expressed by cells of sex cord stromal derivation, and inhibit the secretion of follitropin by the pituitary gland. Inhibins are also involved in regulating diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins, as inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibin has 2 subunits (alpha and beta) that are coded by separate genes. The alpha subunit determines whether inhibin or activin will be produced. The alpha subunit remains constant, such that the various types of inhibin are defined by the beta subunit (a,b,c,d). Inhibin A is a dimer of alpha and beta A. Inhibin B is a dimer of alpha and beta B. Proteolytic processing yields a number of inhibin alpha bioactive forms: the 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N terminal propeptide linked through a disulfide bond to the mature alpha chain, and the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono or diglycosylated, causing the mass difference.
Sequence:
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Research Backgrounds

Function:

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

PTMs:

Proteolytic processing yields a number of bioactive forms. The 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N-terminal propeptide linked through a disulfide bond to the mature alpha chain, the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono- or diglycosylated, causing the mass difference.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fasciculata in the normal gland, extending centripetally into the zona fasciculata in hyperplasia. Also found in adrenocortical tumors. Also expressed in prostate epithelium of benign prostatic hyperplasia, in regions of basal cell hyperplasia and in nonmalignant regions of high grade prostate cancer. Only circulating inhibin B is found in male, whereas circulating inhibins A and B are found in female.

Subunit Structure:

Dimeric, linked by one or more disulfide bonds. Inhibin A is a dimer of alpha and beta-A. Inhibin B is a dimer of alpha and beta-B.

Family&Domains:

Belongs to the TGF-beta family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.