CD276 Antibody - #BF0660
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# BF0660, RRID:AB_2833842.
Fold/Unfold
4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352;
Immunogens
Purified recombinant fragment of human CD276 expressed in E. Coli.
Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophoblast cells and Hofbauer cells of the first trimester placenta and term placenta.
- Q5ZPR3 CD276_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
PTMs - Q5ZPR3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S106 | Phosphorylation | Uniprot | |
| K144 | Ubiquitination | Uniprot | |
| N322 | N-Glycosylation | Uniprot | |
| S324 | Phosphorylation | Uniprot | |
| K362 | Ubiquitination | Uniprot | |
| N407 | N-Glycosylation | Uniprot | |
| S513 | Phosphorylation | Uniprot | |
| T515 | Phosphorylation | Uniprot | |
| K521 | Ubiquitination | Uniprot | |
| S523 | Phosphorylation | Uniprot | |
| S525 | Phosphorylation | Uniprot | |
| K526 | Ubiquitination | Uniprot |
Research Backgrounds
May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.
Membrane>Single-pass type I membrane protein.
Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophoblast cells and Hofbauer cells of the first trimester placenta and term placenta.
Interacts with TREML2 and this interaction enhances T-cell activation.
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.