ETV5 Antibody - #BF0096
Product: | ETV5 Antibody |
Catalog: | BF0096 |
Description: | Mouse monoclonal antibody to ETV5 |
Application: | WB ELISA |
Reactivity: | Human |
Mol.Wt.: | 58kDa; 58kD(Calculated). |
Uniprot: | P41161 |
RRID: | AB_2833818 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# BF0096, RRID:AB_2833818.
Fold/Unfold
ERM; Ets related protein ERM; ETS translocation variant 5; Ets variant gene 5; Ets-related protein ERM; ETV5; ETV5_HUMAN;
Immunogens
Purified recombinant fragment of human ETV5 expressed in E. Coli.
- P41161 ETV5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY
PTMs - P41161 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y5 | Phosphorylation | Uniprot | |
K89 | Sumoylation | Uniprot | |
S94 | Phosphorylation | Uniprot | |
S248 | Phosphorylation | Uniprot | |
K263 | Sumoylation | Uniprot | |
K293 | Sumoylation | Uniprot | |
S310 | Phosphorylation | Uniprot | |
K329 | Ubiquitination | Uniprot | |
K350 | Sumoylation | Uniprot | |
S367 | Phosphorylation | P17612 (PRKACA) | Uniprot |
Y443 | Phosphorylation | Uniprot | |
K468 | Sumoylation | Uniprot |
Research Backgrounds
Binds to DNA sequences containing the consensus nucleotide core sequence 5'-GGAA.-3'.
Nucleus.
Ubiquitous.
Interacts (via C-terminal) with ZMYM5 (via N-terminal 120 amino acid region).
Belongs to the ETS family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.