CDC25C Antibody - #BF0380

(1)  
Product: CDC25C Antibody
Catalog: BF0380
Description: Mouse monoclonal antibody to CDC25C
Application: WB IHC ELISA
Reactivity: Human, Mouse
Mol.Wt.: 58kDa; 53kD(Calculated).
Uniprot: P30307
RRID: AB_2833774

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFB1750]
Specificity:
CDC25C antibody detects endogenous levels of total CDC25C.
RRID:
AB_2833774
Cite Format: Affinity Biosciences Cat# BF0380, RRID:AB_2833774.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CDC 25; Cdc 25C; CDC25; CDC25C; Cell division cycle 25 homolog C; Cell division cycle 25C; Cell division cycle 25C protein; Dual specificity phosphatase Cdc25C; M phase inducer phosphatase 3; M-phase inducer phosphatase 3; Mitosis inducer CDC25; MPIP3; MPIP3_HUMAN; Phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1, regulatory subunit 60;

Immunogens

Immunogen:

Purified recombinant fragment of human CDC25C expressed in E. Coli.

Uniprot:

P30307(MPIP3_HUMAN) >>Visit HPA database.

Gene(ID):
CDC25C(995)
Description:
a member of the MPI phosphatase family. Activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. Shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. At least four transcript variants for this gene exist. Three splice variant isoforms have been described.
Sequence:
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

PTMs - P30307 As Substrate

Site PTM Type Enzyme
S2 Acetylation
S14 Phosphorylation
S15 Phosphorylation
S17 Phosphorylation
S20 Phosphorylation
K27 Ubiquitination
T37 Phosphorylation
S38 Phosphorylation
T48 Phosphorylation P06493 (CDK1)
K52 Ubiquitination
S57 Phosphorylation
S61 Phosphorylation
S64 Phosphorylation
T67 Phosphorylation P06493 (CDK1)
K69 Ubiquitination
S75 Phosphorylation
S122 Phosphorylation P06493 (CDK1)
S129 Phosphorylation
T130 Phosphorylation P06493 (CDK1)
S146 Phosphorylation
S148 Phosphorylation
K151 Ubiquitination
Y165 Phosphorylation
S168 Phosphorylation P45984 (MAPK9) , P53779 (MAPK10) , P45983 (MAPK8) , P06493 (CDK1)
T171 Phosphorylation
T172 Phosphorylation
S191 Phosphorylation Q9H4B4 (PLK3)
S198 Phosphorylation Q9H4B4 (PLK3) , PR:P53350 (hPLK1) , P53350 (PLK1)
S207 Phosphorylation P53778 (MAPK12)
S209 Phosphorylation
Y212 Phosphorylation
S214 Phosphorylation P06493 (CDK1) , P24941 (CDK2)
S216 Phosphorylation P27361 (MAPK3) , Q13237 (PRKG2) , Q13535 (ATR) , Q683Z8 (CHK2) , P28482 (MAPK1) , Q16539 (MAPK14) , P49137 (MAPKAPK2) , Q16512 (PKN1) , O14757 (CHEK1) , Q9H4B4 (PLK3) , P27448 (MARK3) , P43405 (SYK) , Q8TDC3 (BRSK1) , O96017 (CHEK2)
K233 Ubiquitination
T236 Phosphorylation P68400 (CSNK2A1)
K240 Ubiquitination
K244 Ubiquitination
S247 Phosphorylation Q15418 (RPS6KA1)
K251 Ubiquitination
K260 Ubiquitination
S263 Phosphorylation
S287 Phosphorylation
K288 Ubiquitination
K298 Ubiquitination
K303 Ubiquitination
K317 Ubiquitination
K360 Ubiquitination
Y401 Phosphorylation
K413 Ubiquitination
Y416 Phosphorylation
S449 Phosphorylation
K452 Ubiquitination
K469 Ubiquitination
S472 Phosphorylation

Research Backgrounds

Function:

Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.

PTMs:

Phosphorylated by CHEK1 and MAPK14 at Ser-216. This phosphorylation creates a binding site for 14-3-3 protein and inhibits the phosphatase. Phosphorylated by PLK4. Phosphorylated by PLK1, leading to activate the phosphatase activity. Phosphorylation by PLK3 at Ser-191 promotes nuclear translocation. Ser-198 is a minor phosphorylation site. Was initially reported to be phosphorylated by PLK3 at Ser-216. However, such phosphorylation by PLK3 was not confirmed by other groups. Phosphorylation at Thr-48, Thr-67, Ser-122, Thr-130, Ser-168 and Ser-214 occurs at G2 and G2-M transition and is probably catalyzed by CDK1. Ser-168 phosphorylation levels are lower than those at the other 5 CDK1 sites. Phosphorylation by CDK1 leads to increased activity.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with MAPK14 and 14-3-3 proteins. When phosphorylated on Ser-129 and/or Thr-130, interacts with PLK1.

(Microbial infection) Interacts with HIV-1 Vpr; this interaction inactivates CDC25C phosphatase activity.

Family&Domains:

Belongs to the MPI phosphatase family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.