AGT Antibody - #BF0069
Product: | AGT Antibody |
Catalog: | BF0069 |
Description: | Mouse monoclonal antibody to AGT |
Application: | WB ELISA |
Reactivity: | Human |
Mol.Wt.: | 53kDa; 22kD(Calculated). |
Uniprot: | P16455 |
RRID: | AB_2833719 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# BF0069, RRID:AB_2833719.
Fold/Unfold
6 O methylguanine DNA methyltransferase; 6-O-methylguanine-DNA methyltransferase; Agat; AGT; AI267024; EC 2.1.1.63; Methylated DNA protein cysteine methyltransferase; Methylated-DNA--protein-cysteine methyltransferase; Methylguanine DNA methyltransferase; MGC107020; MGMT; MGMT_HUMAN; O 6 methylguanine DNA alkyltransferase; O 6 methylguanine DNA methyltransferase; O-6-methylguanine-DNA methyltransferase; O-6-methylguanine-DNA-alkyltransferase;
Immunogens
Purified recombinant fragment of human AGT expressed in E. Coli.
- P16455 MGMT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
PTMs - P16455 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K8 | Ubiquitination | Uniprot | |
T10 | Phosphorylation | Uniprot | |
T11 | Phosphorylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
K18 | Ubiquitination | Uniprot | |
S22 | Phosphorylation | Uniprot | |
K32 | Ubiquitination | Uniprot | |
K101 | Ubiquitination | Uniprot | |
K104 | Ubiquitination | Uniprot | |
K125 | Ubiquitination | Uniprot | |
Y158 | Phosphorylation | Uniprot | |
K165 | Acetylation | Uniprot | |
K165 | Ubiquitination | Uniprot | |
K178 | Ubiquitination | Uniprot | |
K193 | Ubiquitination | Uniprot | |
S201 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
Nucleus.
Belongs to the MGMT family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.