KLF15 Antibody - #BF0574

(1)  
Product: KLF15 Antibody
Catalog: BF0574
Description: Mouse monoclonal antibody to KLF15
Application: WB ELISA
Reactivity: Human
Mol.Wt.: 44kDa; 44kD(Calculated).
Uniprot: Q9UIH9
RRID: AB_2833692

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFB1668]
Specificity:
KLF15 antibody detects endogenous levels of total KLF15.
RRID:
AB_2833692
Cite Format: Affinity Biosciences Cat# BF0574, RRID:AB_2833692.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Kidney enriched Kruppel like factor; Kidney-enriched krueppel-like factor; KKLF; KKLF protein; KLF 15; KLF15; KLF15_HUMAN; Krueppel-like factor 15; Kruppel like factor 15;

Immunogens

Immunogen:

Purified recombinant fragment of human KLF15 expressed in E. Coli.

Uniprot:

Q9UIH9(KLF15_HUMAN) >>Visit HPA database.

Gene(ID):
KLF15(28999)
Expression:
Q9UIH9 KLF15_HUMAN:

Highly expressed in liver, skeletal muscle, and kidney. Expressed in cardiomyocytes. Expression is highly reduced in cardiac tissue of patients with non-ischemic cardiomyopathy and aortic aneurysm, and in glomerular disease. Not expressed in bone marrow or lymphoid tissues.

Description:
KLF15 (Kruppel-like factor 15), also known as KKLF, DKFZp779M1320. Entrez Protein NP_054798. Sequence analysis predicted that the 416 amino acid KLF15 protein, which is 84% identical to the rat Klf15 protein, contains 3 zinc finger motifs at its C terminus, N-terminal serine-rich stretches, and a central proline-rich segment.KLF15, a kidney-enriched Krueppel-like factor, is a transcriptonal activator that binds the CLCNKA promoter. KLF15, which is a nuclear protein, is expressed primarily in liver, heart, skeletal muscle and kidney tissues but is not detected in lymphoid tissues or bone marrow. KLF15 is an important regulator of GLUT4 in both adipose and muscle tissues.
Sequence:
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

PTMs - Q9UIH9 As Substrate

Site PTM Type Enzyme
S186 Phosphorylation
S187 Phosphorylation
K339 Sumoylation
K339 Ubiquitination

Research Backgrounds

Function:

Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of cardiac fibrosis. It is also involved in the control of cardiac hypertrophy acting through the inhibition of MEF2A and GATA4 (By similarity). Involved in podocyte differentiation (By similarity). Inhibits MYOCD activity. Is a negative regulator of TP53 acetylation. Inhibits NF-kappa-B activation through repression of EP300-dependent RELA acetylation.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in liver, skeletal muscle, and kidney. Expressed in cardiomyocytes. Expression is highly reduced in cardiac tissue of patients with non-ischemic cardiomyopathy and aortic aneurysm, and in glomerular disease. Not expressed in bone marrow or lymphoid tissues.

Subunit Structure:

Interacts with MYOCD and EP300.

Family&Domains:

The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.

Belongs to the Sp1 C2H2-type zinc-finger protein family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.